KEGG   Ursus maritimus (polar bear): 103657827
Entry
103657827         CDS       T03271                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr01524  Platinum drug resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04062  Chemokine signaling pathway
umr04066  HIF-1 signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04114  Oocyte meiosis
umr04140  Autophagy - animal
umr04148  Efferocytosis
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04350  TGF-beta signaling pathway
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04380  Osteoclast differentiation
umr04510  Focal adhesion
umr04517  IgSF CAM signaling
umr04520  Adherens junction
umr04540  Gap junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04611  Platelet activation
umr04613  Neutrophil extracellular trap formation
umr04620  Toll-like receptor signaling pathway
umr04621  NOD-like receptor signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04657  IL-17 signaling pathway
umr04658  Th1 and Th2 cell differentiation
umr04659  Th17 cell differentiation
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04666  Fc gamma R-mediated phagocytosis
umr04668  TNF signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04723  Retrograde endocannabinoid signaling
umr04724  Glutamatergic synapse
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04914  Progesterone-mediated oocyte maturation
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04928  Parathyroid hormone synthesis, secretion and action
umr04929  GnRH secretion
umr04930  Type II diabetes mellitus
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04934  Cushing syndrome
umr04935  Growth hormone synthesis, secretion and action
umr04960  Aldosterone-regulated sodium reabsorption
umr05010  Alzheimer disease
umr05020  Prion disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05034  Alcoholism
umr05132  Salmonella infection
umr05133  Pertussis
umr05135  Yersinia infection
umr05140  Leishmaniasis
umr05142  Chagas disease
umr05145  Toxoplasmosis
umr05152  Tuberculosis
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05164  Influenza A
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05171  Coronavirus disease - COVID-19
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05207  Chemical carcinogenesis - receptor activation
umr05208  Chemical carcinogenesis - reactive oxygen species
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05212  Pancreatic cancer
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103657827 (MAPK3)
   04012 ErbB signaling pathway
    103657827 (MAPK3)
   04014 Ras signaling pathway
    103657827 (MAPK3)
   04015 Rap1 signaling pathway
    103657827 (MAPK3)
   04350 TGF-beta signaling pathway
    103657827 (MAPK3)
   04370 VEGF signaling pathway
    103657827 (MAPK3)
   04371 Apelin signaling pathway
    103657827 (MAPK3)
   04668 TNF signaling pathway
    103657827 (MAPK3)
   04066 HIF-1 signaling pathway
    103657827 (MAPK3)
   04068 FoxO signaling pathway
    103657827 (MAPK3)
   04072 Phospholipase D signaling pathway
    103657827 (MAPK3)
   04071 Sphingolipid signaling pathway
    103657827 (MAPK3)
   04024 cAMP signaling pathway
    103657827 (MAPK3)
   04022 cGMP-PKG signaling pathway
    103657827 (MAPK3)
   04151 PI3K-Akt signaling pathway
    103657827 (MAPK3)
   04150 mTOR signaling pathway
    103657827 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    103657827 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103657827 (MAPK3)
   04148 Efferocytosis
    103657827 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103657827 (MAPK3)
   04210 Apoptosis
    103657827 (MAPK3)
   04218 Cellular senescence
    103657827 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103657827 (MAPK3)
   04520 Adherens junction
    103657827 (MAPK3)
   04540 Gap junction
    103657827 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103657827 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103657827 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103657827 (MAPK3)
   04613 Neutrophil extracellular trap formation
    103657827 (MAPK3)
   04620 Toll-like receptor signaling pathway
    103657827 (MAPK3)
   04621 NOD-like receptor signaling pathway
    103657827 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    103657827 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    103657827 (MAPK3)
   04660 T cell receptor signaling pathway
    103657827 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    103657827 (MAPK3)
   04659 Th17 cell differentiation
    103657827 (MAPK3)
   04657 IL-17 signaling pathway
    103657827 (MAPK3)
   04662 B cell receptor signaling pathway
    103657827 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    103657827 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    103657827 (MAPK3)
   04062 Chemokine signaling pathway
    103657827 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103657827 (MAPK3)
   04929 GnRH secretion
    103657827 (MAPK3)
   04912 GnRH signaling pathway
    103657827 (MAPK3)
   04915 Estrogen signaling pathway
    103657827 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    103657827 (MAPK3)
   04917 Prolactin signaling pathway
    103657827 (MAPK3)
   04921 Oxytocin signaling pathway
    103657827 (MAPK3)
   04926 Relaxin signaling pathway
    103657827 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    103657827 (MAPK3)
   04919 Thyroid hormone signaling pathway
    103657827 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    103657827 (MAPK3)
   04916 Melanogenesis
    103657827 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103657827 (MAPK3)
   04270 Vascular smooth muscle contraction
    103657827 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103657827 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103657827 (MAPK3)
   04725 Cholinergic synapse
    103657827 (MAPK3)
   04726 Serotonergic synapse
    103657827 (MAPK3)
   04720 Long-term potentiation
    103657827 (MAPK3)
   04730 Long-term depression
    103657827 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    103657827 (MAPK3)
   04722 Neurotrophin signaling pathway
    103657827 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    103657827 (MAPK3)
   04380 Osteoclast differentiation
    103657827 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103657827 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103657827 (MAPK3)
   05206 MicroRNAs in cancer
    103657827 (MAPK3)
   05205 Proteoglycans in cancer
    103657827 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    103657827 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    103657827 (MAPK3)
   05203 Viral carcinogenesis
    103657827 (MAPK3)
   05230 Central carbon metabolism in cancer
    103657827 (MAPK3)
   05231 Choline metabolism in cancer
    103657827 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103657827 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103657827 (MAPK3)
   05212 Pancreatic cancer
    103657827 (MAPK3)
   05225 Hepatocellular carcinoma
    103657827 (MAPK3)
   05226 Gastric cancer
    103657827 (MAPK3)
   05214 Glioma
    103657827 (MAPK3)
   05216 Thyroid cancer
    103657827 (MAPK3)
   05221 Acute myeloid leukemia
    103657827 (MAPK3)
   05220 Chronic myeloid leukemia
    103657827 (MAPK3)
   05218 Melanoma
    103657827 (MAPK3)
   05211 Renal cell carcinoma
    103657827 (MAPK3)
   05219 Bladder cancer
    103657827 (MAPK3)
   05215 Prostate cancer
    103657827 (MAPK3)
   05213 Endometrial cancer
    103657827 (MAPK3)
   05224 Breast cancer
    103657827 (MAPK3)
   05223 Non-small cell lung cancer
    103657827 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103657827 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    103657827 (MAPK3)
   05161 Hepatitis B
    103657827 (MAPK3)
   05160 Hepatitis C
    103657827 (MAPK3)
   05171 Coronavirus disease - COVID-19
    103657827 (MAPK3)
   05164 Influenza A
    103657827 (MAPK3)
   05163 Human cytomegalovirus infection
    103657827 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103657827 (MAPK3)
   05165 Human papillomavirus infection
    103657827 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103657827 (MAPK3)
   05135 Yersinia infection
    103657827 (MAPK3)
   05133 Pertussis
    103657827 (MAPK3)
   05152 Tuberculosis
    103657827 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103657827 (MAPK3)
   05140 Leishmaniasis
    103657827 (MAPK3)
   05142 Chagas disease
    103657827 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103657827 (MAPK3)
   05020 Prion disease
    103657827 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    103657827 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    103657827 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103657827 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103657827 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103657827 (MAPK3)
   04934 Cushing syndrome
    103657827 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103657827 (MAPK3)
   01524 Platinum drug resistance
    103657827 (MAPK3)
   01522 Endocrine resistance
    103657827 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:umr01001]
    103657827 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:umr03036]
    103657827 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103657827 (MAPK3)
Enzymes [BR:umr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103657827 (MAPK3)
Protein kinases [BR:umr01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103657827 (MAPK3)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103657827 (MAPK3)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103657827 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 103657827
NCBI-ProteinID: XP_040491056
UniProt: A0A8M1G600
LinkDB
Position
Unknown
AA seq 379 aa
MAAAAAQGGGGGEPRGADGVGPGVSGEVEVVKGQPFDVGPRYTELHYIGEGAYGMVSSAY
DHVRKIRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggcggggagccccggggagctgatggggtc
ggcccgggggtctcgggggaggtggaggtagtgaaggggcagccgttcgacgtgggcccg
cgctacacggagctgcattacatcggcgagggcgcgtacggcatggtcagctcagcttac
gaccacgtgcgcaagattcgcgtggccatcaagaaaatcagccccttcgagcatcagacc
tactgccagcgcacactgcgggagatccagatcttgctgcgcttccgccacgagaacgtc
attggcattcgggacattctgcgggcgcccaccctggaagccatgagagatgtctacatt
gtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagcaac
gaccatgtttgctacttcctctaccagatcctgcggggcctcaagtacatccactcagcc
aacgtgctccaccgggatctaaagccctctaacctgctcatcaacaccacctgcgacctt
aagatctgcgattttggcctggcccggattgcggaccctgagcatgaccacactggcttc
ctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaactctaag
ggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccctggcaagcactacctggaccagctcaaccacattctgggtatc
ctgggctccccatcccaggaggacttgaattgtatcatcaatatgaaggcccgaaactac
ctgcagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaagtcggac
tccaaagcccttgacctgctagaccggatgttgacctttaaccccaacaaacggatcaca
gtggaagaagcgctggctcacccctacttggagcagtactacgacccaacagatgagccg
gtggccgaggagcctttcacctttgacatggagctggatgatctacccaaggagcggctg
aaggagctcatcttccaggagacagcccgcttccagcctggggcgctggaggccccctaa

DBGET integrated database retrieval system