Ursus maritimus (polar bear): 103660338 Help Entry 103660338         CDS       T03271                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism umr  Ursus maritimus (polar bear) Pathway umr04015   Rap1 signaling pathway umr04810   Regulation of actin cytoskeleton umr05014   Amyotrophic lateral sclerosis umr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103660338 (PFN1)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103660338 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103660338 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:umr04812]     103660338 (PFN1)    04147 Exosome [BR:umr04147]     103660338 (PFN1) Membrane trafficking [BR:umr04131]  Others   Actin-binding proteins    Others     103660338 (PFN1) Cytoskeleton proteins [BR:umr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103660338 (PFN1) Exosome [BR:umr04147]  Exosomal proteins   Proteins found in most exosomes    103660338 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103660338 NCBI-ProteinID:  XP_040485815 UniProt:  A0A8M1FTN9 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtccagttttttc gtgaacggcctgacacttgggggccagaaatgttctgttatccgggactcactgctgcag gacggggagtttaccatggatcttcgtaccaagagcaccggtggcgctcccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system