Ursus maritimus (polar bear): 103661476 Help Entry 103661476         CDS       T03271                                  Name (RefSeq) elongin-C-like   KO K03872   elongin-C Organism umr  Ursus maritimus (polar bear) Pathway umr04066   HIF-1 signaling pathway umr04120   Ubiquitin mediated proteolysis umr05170   Human immunodeficiency virus 1 infection umr05200   Pathways in cancer umr05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103661476  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103661476  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103661476   09162 Cancer: specific types    05211 Renal cell carcinoma     103661476   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103661476  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:umr04121]     103661476    03400 DNA repair and recombination proteins [BR:umr03400]     103661476 Ubiquitin system [BR:umr04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      103661476    Cul5 complex      103661476 DNA repair and recombination proteins [BR:umr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103661476 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  103661476 NCBI-ProteinID:  XP_040481528 UniProt:  A0A8M1FDQ8 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MSVKSIPLDGHEFIIKRRHALTSGTIKAMLSGPDRFAESEINEVNFRDIPSHVLSKVRMY FTYEVHYTNSSMKIPGFPTAPEIVGGWLMAANFLDCYTR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctgtcaaatcgatacctttggatggtcatgaatttattataaaaagacgacatgca ctaacatccggaacaataaaagccatgttgagtggcccagatcggtttgctgagagtgaa attaacgaagtcaattttagagacatcccttcacacgtgctgtcaaaagtacgcatgtat tttacctacgaggttcactacacgaacagctccatgaagattccgggattcccaactgca cctgaaattgtagggggatggctgatggccgccaacttcctagattgttacacaagataa

DBGET integrated database retrieval system