Ursus maritimus (polar bear): 103662584 Help Entry 103662584         CDS       T03271                                  Name (RefSeq) thioredoxin-like   KO K03671   thioredoxin Organism umr  Ursus maritimus (polar bear) Pathway umr04621   NOD-like receptor signaling pathway umr05012   Parkinson disease umr05132   Salmonella infection umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103662584  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103662584   09164 Neurodegenerative disease    05012 Parkinson disease     103662584   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103662584  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:umr03110]     103662584 Chaperones and folding catalysts [BR:umr03110]  Protein folding catalysts   Protein disulfide isomerase    103662584 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_2 Thioredoxin_7 DIM1 AhpC-TSA Thioredoxin_9 Redoxin Glutaredoxin OST3_OST6 HyaE Motif Other DBs NCBI-GeneID:  103662584 NCBI-ProteinID:  XP_040500721 UniProt:  A0A452TY20 LinkDB All DBs Position X AA seq 105 aa AA seqDB search MVKQIKSKYSFQEALNSAGDKPVVVDFSATWCGPCKMTKPFFHPLSEKYSNVVSLEVDVD DCQDVASECKVKCMPTFHFFRKGQKVGEFSGTNKGKLEATINELT NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagataaagagcaagtattcttttcaggaagccttgaacagtgcaggagat aaaccagttgtagttgacttctcagccacatggtgtgggccttgcaaaatgaccaagcct ttctttcatcccctctctgagaagtattccaacgtggtatcccttgaagtagatgtggat gactgtcaggatgtcgcttcagaatgtaaagtcaaatgcatgccaaccttccattttttt agaaagggacaaaaggtgggtgaattttctggaactaataaggggaaacttgaagctacc attaatgaattaacctaa

DBGET integrated database retrieval system