Ursus maritimus (polar bear): 103662848 Help Entry 103662848         CDS       T03271                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism umr  Ursus maritimus (polar bear) Pathway umr04022   cGMP-PKG signaling pathway umr04270   Vascular smooth muscle contraction umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     103662848 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103662848 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103662848 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103662848 (NPPC) Cytokines and neuropeptides [BR:umr04052]  Neuropeptides   Neuropeptides (Unclassified)    103662848 (NPPC) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103662848 NCBI-ProteinID:  XP_008688778 UniProt:  A0A384C1R4 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPGEELAEPQAAGGGQKKGDKTPGGG GANLKGDRSRLLRDLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcacgctactctcgctgcggccc tccgaagccaagcccggggcgccgccgaaggtcccgcgaactccgccgggggaggagctg gccgagccccaggctgcgggcggcggtcagaagaagggcgacaaaactcccgggggcggc ggcgccaacctcaagggtgaccggtcgcgactgctccgcgacctgcgcgtggacaccaag tctcgggccgcgtgggcccgccttctgcatgagcaccccaacgcgcgcaaatacaaagga ggcaacaagaagggcttgtccaagggctgcttcggcctcaagctggaccggatcggctcc atgagcggcttgggatgttag

DBGET integrated database retrieval system