Ursus maritimus (polar bear): 103664443 Help Entry 103664443         CDS       T03271                                  Symbol PFN3 Name (RefSeq) LOW QUALITY PROTEIN: profilin-3   KO K05759   profilin Organism umr  Ursus maritimus (polar bear) Pathway umr04015   Rap1 signaling pathway umr04810   Regulation of actin cytoskeleton umr05014   Amyotrophic lateral sclerosis umr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103664443 (PFN3)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103664443 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103664443 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:umr04812]     103664443 (PFN3)    04147 Exosome [BR:umr04147]     103664443 (PFN3) Membrane trafficking [BR:umr04131]  Others   Actin-binding proteins    Others     103664443 (PFN3) Cytoskeleton proteins [BR:umr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103664443 (PFN3) Exosome [BR:umr04147]  Exosomal proteins   Proteins found in most exosomes    103664443 (PFN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin TAT_signal Motif Other DBs NCBI-GeneID:  103664443 NCBI-ProteinID:  XP_008690536 UniProt:  A0A384C6L3 LinkDB All DBs Position Unknown AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRRTFL QAGLSVAGXXCCVIRDHLLSEGDGVLDARTKGLDGRAVCVGHTPRVLLVLMGRRGVHGGI LNKTVHELIKGLRTQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggagactggaaaggctatatcagtgcggtgctgcgggaccagcgcattgacgatgtg gccatcgtgggccactcagacaatcgctgcgtgtgggcatcgcgtccaggaggccttctg gctgccatatcaccgcaagaggtgggtgtgctcacagggcctgatcggcgcaccttcctg caggccggcctgagcgtggcaggnnnnnnctgctgcgtcatccgcgaccacttgctgtct gagggcgatggagttctggacgcacgcactaaggggctggatgggcgtgcggtctgcgtg ggccacaccccgcgcgtgctcctcgtgctcatgggccgacggggcgtgcacgggggcatc ctcaacaagacagtgcatgaactaatcaaggggctgcgcacacagggcacctag

DBGET integrated database retrieval system