Ursus maritimus (polar bear): 103664844 Help Entry 103664844         CDS       T03271                                  Symbol CCL28 Name (RefSeq) C-C motif chemokine 28   KO K05513   C-C motif chemokine 28 Organism umr  Ursus maritimus (polar bear) Pathway umr04060   Cytokine-cytokine receptor interaction umr04061   Viral protein interaction with cytokine and cytokine receptor umr04062   Chemokine signaling pathway umr04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103664844 (CCL28)    04061 Viral protein interaction with cytokine and cytokine receptor     103664844 (CCL28)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     103664844 (CCL28)    04062 Chemokine signaling pathway     103664844 (CCL28)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103664844 (CCL28) Cytokines and neuropeptides [BR:umr04052]  Cytokines   Chemokines    103664844 (CCL28) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103664844 NCBI-ProteinID:  XP_040486558 UniProt:  A0A452TMH1 LinkDB All DBs Position Unknown AA seq 109 aa AA seqDB search PQTPILPIASSCCTEVSHHISRRLLERVNLCRIQKADGDCDLAAVILHIRRRRICVSPHS HVIKQWMKEQAAKKNAKGNMCHKKKHAGQRKSKGAHPGKPETQAHKTPY NT seq 330 nt NT seq  +upstreamnt  +downstreamnt ccgcagacacccatacttcccattgcctccagctgttgcactgaagtttcacatcatatc tccagaaggcttctggagagagtgaatctatgtcgcatccagaaagctgatggcgattgt gacttggctgctgtcatccttcacatcaggcgcagaagaatctgtgtcagcccgcacagt cacgttattaagcagtggatgaaagaacaagcagccaagaaaaacgctaaaggcaacatg tgccacaagaagaaacacgccggccagaggaaaagtaaaggggcacatccggggaaacca gaaacccaggcccataaaactccttattag

DBGET integrated database retrieval system