Ursus maritimus (polar bear): 103665040 Help Entry 103665040         CDS       T03271                                  Name (RefSeq) histone H2A type 1-B-like   KO K11251   histone H2A Organism umr  Ursus maritimus (polar bear) Pathway umr03082   ATP-dependent chromatin remodeling umr04217   Necroptosis umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103665040  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103665040  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103665040  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     103665040   09165 Substance dependence    05034 Alcoholism     103665040  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103665040   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103665040 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103665040 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103665040 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  103665040 NCBI-ProteinID:  XP_008691171 UniProt:  A0A384C8G0 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGSKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggaaagcaggggagtaaaacccgagccaaggctaagacgcgctcctcg cgggccggccttcagttcccggtgggccgtgtgcaccgtctgctccgcaaaggcaactat tcggagcgggtcggggccggcgcgcccgtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc gtgaccatcgcgcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag actgagagccaccacaaggccaaggggaagtaa

DBGET integrated database retrieval system