Ursus maritimus (polar bear): 103665204 Help Entry 103665204         CDS       T03271                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05202   Transcriptional misregulation in cancer umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103665204  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103665204   09163 Immune disease    05322 Systemic lupus erythematosus     103665204   09165 Substance dependence    05034 Alcoholism     103665204  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103665204   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103665204 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103665204 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103665204 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103665204 NCBI-ProteinID:  XP_008691320 UniProt:  A0A384C8I7 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagacggcgcgtaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagagggcctga

DBGET integrated database retrieval system