Ursus maritimus (polar bear): 103665472 Help Entry 103665472         CDS       T03271                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism umr  Ursus maritimus (polar bear) Pathway umr04014   Ras signaling pathway umr04072   Phospholipase D signaling pathway umr04144   Endocytosis umr04517   IgSF CAM signaling umr04666   Fc gamma R-mediated phagosome formation umr05132   Salmonella infection umr05135   Yersinia infection Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103665472 (ARF6)    04072 Phospholipase D signaling pathway     103665472 (ARF6)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103665472 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103665472 (ARF6)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     103665472 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103665472 (ARF6)    05135 Yersinia infection     103665472 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103665472 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103665472 (ARF6)    04031 GTP-binding proteins [BR:umr04031]     103665472 (ARF6) Membrane trafficking [BR:umr04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103665472 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     103665472 (ARF6) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103665472 (ARF6)   Exosomal proteins of colorectal cancer cells    103665472 (ARF6) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     103665472 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  103665472 NCBI-ProteinID:  XP_008691636 UniProt:  A0A384C9T2 LinkDB All DBs Position Unknown AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atggggaaggtgctgtccaagatcttcgggaacaaggaaatgcggatcctcatgttgggc ctggacgcggccggcaagacgacaatcctgtacaagctgaagctgggccagtcggtgacc accattcccaccgtgggtttcaacgtggagacggtgacttacaaaaacgtcaagttcaac gtgtgggacgtgggcggccaggacaagatccggccgctctggcggcattactacaccggg acccagggtctgatcttcgtagtggactgcgccgaccgcgaccgcatcgacgaggcccgc caggagctgcaccgcattatcaatgaccgggagatgagggacgccataatcctcatcttc gccaacaaacaggacctgcccgatgccatgaaaccccacgagatccaggagaaactgggc ctgacccggattcgggacaggaactggtatgtgcagccctcctgtgccacctcaggggat ggactctatgaggggctcacatggttaacctctaactacaaatcctaa

DBGET integrated database retrieval system