Ursus maritimus (polar bear): 103666055 Help Entry 103666055         CDS       T03271                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism umr  Ursus maritimus (polar bear) Pathway umr04024   cAMP signaling pathway umr04062   Chemokine signaling pathway umr04064   NF-kappa B signaling pathway umr04210   Apoptosis umr04380   Osteoclast differentiation umr04519   Cadherin signaling umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04623   Cytosolic DNA-sensing pathway umr04625   C-type lectin receptor signaling pathway umr04657   IL-17 signaling pathway umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04662   B cell receptor signaling pathway umr04668   TNF signaling pathway umr04722   Neurotrophin signaling pathway umr04920   Adipocytokine signaling pathway umr04926   Relaxin signaling pathway umr04931   Insulin resistance umr04936   Alcoholic liver disease umr05132   Salmonella infection umr05134   Legionellosis umr05135   Yersinia infection umr05140   Leishmaniasis umr05142   Chagas disease umr05145   Toxoplasmosis umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease umr05200   Pathways in cancer umr05203   Viral carcinogenesis umr05208   Chemical carcinogenesis - reactive oxygen species umr05215   Prostate cancer umr05220   Chronic myeloid leukemia umr05222   Small cell lung cancer umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103666055 (NFKBIA)    04668 TNF signaling pathway     103666055 (NFKBIA)    04024 cAMP signaling pathway     103666055 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     103666055 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103666055 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103666055 (NFKBIA)    04621 NOD-like receptor signaling pathway     103666055 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     103666055 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     103666055 (NFKBIA)    04625 C-type lectin receptor signaling pathway     103666055 (NFKBIA)    04660 T cell receptor signaling pathway     103666055 (NFKBIA)    04658 Th1 and Th2 cell differentiation     103666055 (NFKBIA)    04659 Th17 cell differentiation     103666055 (NFKBIA)    04657 IL-17 signaling pathway     103666055 (NFKBIA)    04662 B cell receptor signaling pathway     103666055 (NFKBIA)    04062 Chemokine signaling pathway     103666055 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103666055 (NFKBIA)    04926 Relaxin signaling pathway     103666055 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103666055 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     103666055 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103666055 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     103666055 (NFKBIA)    05203 Viral carcinogenesis     103666055 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103666055 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     103666055 (NFKBIA)    05215 Prostate cancer     103666055 (NFKBIA)    05222 Small cell lung cancer     103666055 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103666055 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     103666055 (NFKBIA)    05161 Hepatitis B     103666055 (NFKBIA)    05160 Hepatitis C     103666055 (NFKBIA)    05171 Coronavirus disease     103666055 (NFKBIA)    05164 Influenza A     103666055 (NFKBIA)    05162 Measles     103666055 (NFKBIA)    05168 Herpes simplex virus 1 infection     103666055 (NFKBIA)    05163 Human cytomegalovirus infection     103666055 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     103666055 (NFKBIA)    05169 Epstein-Barr virus infection     103666055 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103666055 (NFKBIA)    05135 Yersinia infection     103666055 (NFKBIA)    05134 Legionellosis     103666055 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103666055 (NFKBIA)    05140 Leishmaniasis     103666055 (NFKBIA)    05142 Chagas disease     103666055 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103666055 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103666055 (NFKBIA)    04931 Insulin resistance     103666055 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:umr03000]     103666055 (NFKBIA)    04131 Membrane trafficking [BR:umr04131]     103666055 (NFKBIA) Transcription factors [BR:umr03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     103666055 (NFKBIA) Membrane trafficking [BR:umr04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     103666055 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  103666055 NCBI-ProteinID:  XP_040476771 UniProt:  A0A8M1F0I2 LinkDB All DBs Position Unknown AA seq 314 aa AA seqDB search MFQPAEHAQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEDYEQLVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCRTQHLYSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNSDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcacgcccaggactgggccatggagggtccgcgggacgcgctc aagaaggagcggctgctggacgaccgccacgacagcggcctggactccatgaaggacgag gactacgagcagttggtgaaggagctgcgggagatccgcctcgagccgcaggaggcgccg cggggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtgatccgccaagtgaagggcgac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccaaccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcaaggctgcctcgccagtgtg ggagtcctgactcagacctgcaggacccagcacctctactccatcctccaggccaccaac tacaatggtcacacgtgtctacatttggcctctatccatggttacttgggcatcgtggag cttttggtgtctttgggtgctgatgtcaatgctcaggagccctgtaatggtcgaacagcc ctccatcttgcagtggacctgcagaattctgacctcgtgtcactcttgttgaagtgcggg gctgacgtcaaccgagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacgcggatacagcagcagctgggccagctgaccctagaaaaccttcagatgctg ccggagagtgaggatgaggagagctacgacacggagtcagagttcacggaagacgagcta ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system