KEGG   Ursus maritimus (polar bear): 103666854
Entry
103666854         CDS       T03271                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103666854 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:umr04050]
    103666854 (TNFRSF8)
   04090 CD molecules [BR:umr04090]
    103666854 (TNFRSF8)
Cytokine receptors [BR:umr04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   103666854 (TNFRSF8)
CD molecules [BR:umr04090]
 Proteins
  103666854 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 103666854
NCBI-ProteinID: XP_008693155
UniProt: A0A384CFF3
LinkDB
Position
Un
AA seq 497 aa
MFCVTSAINSCARCEPHSTCAPGMVVQFRGTAERDTVCEAPSPVTSPDCSTNPEACQAPT
SSTTRRAGPLGSSSASSRARTRTMLLGGGASLTLEDDSTMTRAPSSPSSVRKPSPDPGPT
SQQPCAQGSSDCGKQCDPDYYLDRDGRCKACVTCSGDLVEKTPCTWNSSRVCECRAGMFC
ATSATNSCARCNPHSACPPGMVTKAQGAVERDAPGESPPPEARPECSTNPQDSKAPTSAT
APLVSSADPQISKEHGGGITHAWGDTPISTSMPISFSSTGKPVLVSGPVLVWTVLLLVVV
LGSVSFLLCHRRACRKWIQQKLHLCYPVQTFRPKLEPVDSRPRRNPTQLKSISVVDSGMG
ELGLMSPPAVESPPNGAACLESMRLLEASPPAAGSPSSPRDLPEPRVTSEHTNNRIDKIY
IMKADTVIVGTVRTEVPEGRGLVALVGPEFEEDLEVDHAPRFPEQETEPPLGSCGDVMFS
VEEEGKEAPLPMTVSEK
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgttctgtgtcacctcagccatcaactcctgtgcccgctgtgagccccactccacctgc
gcaccagggatggtcgtccagttccggggcacagcagagagggacaccgtctgtgaggca
ccttccccagtgaccagccctgactgcagcaccaaccccgaagcctgccaggctcccacc
agcagcaccacccgccgggccgggccgcttggttcttcctcagcaagctccagggccagg
accaggaccatgcttcttggagggggcgcttccctcactctggaagatgattccacaatg
acgagggcccccagctctccctcctcggtgcggaagcccagtccagatccagggccgacc
tcgcagcagccgtgcgcacaggggtcatcggactgtgggaagcagtgtgaccccgactac
tacctggacagggacggccgctgcaaggcctgtgtgacctgttctggagacctggtggag
aagacgccgtgcacgtggaactcctctcgagtctgcgaatgtcgagctggtatgttctgt
gccacgtcagccaccaactcctgtgcacgctgtaacccccactccgcctgcccaccaggg
atggtcaccaaagcccagggtgcggtcgagagggatgcccccggtgagtcgcctcccccc
gaggcccgccctgagtgcagcaccaacccacaggacagcaaggcgcccaccagcgccacg
gcccctctggtctcctcggcagacccccagatcagtaaggagcatggagggggcatcacc
cacgcctggggagacacccccatatcaacaagcatgcccatctctttctcttccacggga
aagcccgttctggtttcagggccagtgctcgtctggacggtcttgctcctggtggtggtt
ttgggctccgtgtctttcctactgtgccaccggagggcctgcaggaagtggattcagcag
aagctccacctgtgctaccccgtccagaccttccggcccaagctggagcctgtggactcc
aggcccaggaggaacccgacacagctgaagagcatatcggtggtggactcgggcatggga
gagctgggcttgatgagccccccggctgtggagagcccccccaacggggcagcctgccta
gagagcatgcggctgctggaagccagcccccctgctgctgggagcccctcatcccccagg
gacctccccgagccccgggtgacctcggagcataccaacaacaggatcgacaagatctac
atcatgaaggctgacacggtgattgtggggaccgtgaggaccgaggtgcctgagggccgg
ggcctggtggcgctggtggggcccgagttcgaggaggatctggaagtggaccatgcccct
cgcttcccggagcaggagacagagccgcctctgggcagctgcggggatgtcatgttctca
gtagaagaggaaggaaaggaggcccccttgcccatgactgtctcagagaaatga

DBGET integrated database retrieval system