Ursus maritimus (polar bear): 103667153 Help Entry 103667153         CDS       T03271                                  Name (RefSeq) histone H3.3A isoform X2   KO K11253   histone H3 Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05202   Transcriptional misregulation in cancer umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103667153  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103667153   09163 Immune disease    05322 Systemic lupus erythematosus     103667153   09165 Substance dependence    05034 Alcoholism     103667153  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103667153   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103667153 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103667153 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103667153 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103667153 NCBI-ProteinID:  XP_008693497 UniProt:  A0A384CAW7 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatctaccggtggtaaagcaccaaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgatccgcaaacttcctttccagcgtctggtgcgagaaattgctcaggacttcaaa acagatctgcgcttccagagtgcagctatcggtgctttgcaggaggcaagcgaggcctat ctggtgggcctcttcgaagacaccaacctgtgtgctatccatgccaaacgtgtcacaatt atgccaaaagacatccagctagcgcgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system