Ursus maritimus (polar bear): 103667299 Help Entry 103667299         CDS       T03271                                  Name (RefSeq) regakine-1-like   KO K05408   C-C motif chemokine 3 Organism umr  Ursus maritimus (polar bear) Pathway umr04060   Cytokine-cytokine receptor interaction umr04061   Viral protein interaction with cytokine and cytokine receptor umr04062   Chemokine signaling pathway umr04620   Toll-like receptor signaling pathway umr05142   Chagas disease umr05163   Human cytomegalovirus infection umr05323   Rheumatoid arthritis umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103667299    04061 Viral protein interaction with cytokine and cytokine receptor     103667299  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103667299    04062 Chemokine signaling pathway     103667299  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103667299   09174 Infectious disease: parasitic    05142 Chagas disease     103667299   09163 Immune disease    05323 Rheumatoid arthritis     103667299   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103667299  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103667299    00536 Glycosaminoglycan binding proteins [BR:umr00536]     103667299 Cytokines and neuropeptides [BR:umr04052]  Cytokines   Chemokines    103667299 Glycosaminoglycan binding proteins [BR:umr00536]  Heparan sulfate / Heparin   Chemokines    103667299 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 BRI3BP CXCL16 Motif Other DBs NCBI-GeneID:  103667299 NCBI-ProteinID:  XP_008693644 UniProt:  A0A384CGP5 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MKVILALLVFLLILVALHSEANEESVKLNPVVCCFAYTTRKVPLRFVKGYDRTSDQCSTP GVIFLTRHNRQICANPDVPWVQEYIRHLDNMSN NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggtcatcctggctctcctggtcttcctcctcattcttgttgcccttcactctgag gccaatgaagaatcagttaaattaaaccccgttgtgtgctgttttgcctacaccacacgg aaagtcccactccggtttgtgaaaggttatgatagaaccagtgaccagtgctccacccca ggggtcatcttccttacccgacataaccgacagatctgtgccaaccccgatgttccctgg gtgcaggagtacatcagacacttagacaacatgtctaactga

DBGET integrated database retrieval system