Ursus maritimus (polar bear): 103667495 Help Entry 103667495         CDS       T03271                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism umr  Ursus maritimus (polar bear) Pathway umr04382   Cornified envelope formation umr05132   Salmonella infection Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     103667495 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103667495 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103667495 (S100A10) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of microglial cells    103667495 (S100A10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  103667495 NCBI-ProteinID:  XP_040482668 UniProt:  A0A384CG76 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVIHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggctacttaacaaaggaggacctgagagtgctcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctagac cagtgccgagacggcagagtgggctttcagagcttcttctcgctaatcgctgggctcacc atcgcgtgcaatgactattttgtaatacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system