Ursus maritimus (polar bear): 103667571 Help Entry 103667571         CDS       T03271                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05202   Transcriptional misregulation in cancer umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103667571  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103667571   09163 Immune disease    05322 Systemic lupus erythematosus     103667571   09165 Substance dependence    05034 Alcoholism     103667571  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103667571   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103667571 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103667571 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103667571 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103667571 NCBI-ProteinID:  XP_008693968 UniProt:  A0A384CGI7 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacaaagcagaccgcccgcaagtcgaccggtggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtgaagaagccgcac cgctaccggccgggcaccgtggccctgcgggagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag acggacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgagcgaggcctac ctggtggggctgttcgaggacacgaacctgtgcgccatccacgccaagcgcgtcaccatc atgccgaaggacatccagctggctcgccgcatccgcggggagcgggcttaa

DBGET integrated database retrieval system