Ursus maritimus (polar bear): 103667579 Help Entry 103667579         CDS       T03271                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05203   Viral carcinogenesis umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103667579  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103667579   09163 Immune disease    05322 Systemic lupus erythematosus     103667579   09165 Substance dependence    05034 Alcoholism     103667579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103667579 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103667579 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  103667579 NCBI-ProteinID:  XP_008693978 UniProt:  A0A384DE05 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtcgggaaggggaaaaggcggtaagggtttaggcaagggtggtgctaagcgccaccgc aaggtcttgagagataacatccaaggtattactaagccggcgattcggcgccttgctcgg cgtgggggagtcaagcggatctccggcctcatctacgaggagacccggggtgtgctaaag gtgttcctagagaacgtcattcgggacgcagtcacctacaccgagcacgctaagcgcaag acggtcactgctatggatgtggtgtatgccctcaagcggcagggacgcaccctgtatggc ttcggaggctaa

DBGET integrated database retrieval system