Ursus maritimus (polar bear): 103667619 Help Entry 103667619         CDS       T03271                                  Symbol APLN Name (RefSeq) apelin   KO K05225   apelin Organism umr  Ursus maritimus (polar bear) Pathway umr04080   Neuroactive ligand-receptor interaction umr04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     103667619 (APLN)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103667619 (APLN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103667619 (APLN) Cytokines and neuropeptides [BR:umr04052]  Neuropeptides   GPCR binding    103667619 (APLN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Apelin Motif Other DBs NCBI-GeneID:  103667619 NCBI-ProteinID:  XP_040496389 UniProt:  A0A8M1GYE5 LinkDB All DBs Position X AA seq 77 aa AA seqDB search MDLRRCVQALLLLWLSLTAVCGGPLLQPSDGKGLEEGNVRHLVQPRGSRNGPGPWQGGRR KFRRQRPRLSHKGPMPF NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggatctgcggcgctgcgtgcaggcgctcctgctgctctggctctccctgacggcggtg tgtggagggcccctgctgcagccttctgatggcaaggggctggaggagggcaacgtccgc cacctggtgcagcccagagggtcaagaaatggaccagggccctggcagggcggtcggagg aaatttcgccgccagcggccgcgcctctcccacaagggccccatgcctttctga

DBGET integrated database retrieval system