KEGG   Ursus maritimus (polar bear): 103669422
Entry
103669422         CDS       T03271                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr01521  EGFR tyrosine kinase inhibitor resistance
umr01522  Endocrine resistance
umr04010  MAPK signaling pathway
umr04012  ErbB signaling pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04062  Chemokine signaling pathway
umr04068  FoxO signaling pathway
umr04071  Sphingolipid signaling pathway
umr04072  Phospholipase D signaling pathway
umr04137  Mitophagy - animal
umr04140  Autophagy - animal
umr04150  mTOR signaling pathway
umr04151  PI3K-Akt signaling pathway
umr04210  Apoptosis
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr04218  Cellular senescence
umr04360  Axon guidance
umr04370  VEGF signaling pathway
umr04371  Apelin signaling pathway
umr04519  Cadherin signaling
umr04540  Gap junction
umr04550  Signaling pathways regulating pluripotency of stem cells
umr04625  C-type lectin receptor signaling pathway
umr04650  Natural killer cell mediated cytotoxicity
umr04660  T cell receptor signaling pathway
umr04662  B cell receptor signaling pathway
umr04664  Fc epsilon RI signaling pathway
umr04714  Thermogenesis
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04725  Cholinergic synapse
umr04726  Serotonergic synapse
umr04730  Long-term depression
umr04810  Regulation of actin cytoskeleton
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04917  Prolactin signaling pathway
umr04919  Thyroid hormone signaling pathway
umr04921  Oxytocin signaling pathway
umr04926  Relaxin signaling pathway
umr04929  GnRH secretion
umr04933  AGE-RAGE signaling pathway in diabetic complications
umr04935  Growth hormone synthesis, secretion and action
umr05010  Alzheimer disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05034  Alcoholism
umr05160  Hepatitis C
umr05161  Hepatitis B
umr05163  Human cytomegalovirus infection
umr05165  Human papillomavirus infection
umr05166  Human T-cell leukemia virus 1 infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05203  Viral carcinogenesis
umr05205  Proteoglycans in cancer
umr05206  MicroRNAs in cancer
umr05207  Chemical carcinogenesis - receptor activation
umr05208  Chemical carcinogenesis - reactive oxygen species
umr05210  Colorectal cancer
umr05211  Renal cell carcinoma
umr05213  Endometrial cancer
umr05214  Glioma
umr05215  Prostate cancer
umr05216  Thyroid cancer
umr05218  Melanoma
umr05219  Bladder cancer
umr05220  Chronic myeloid leukemia
umr05221  Acute myeloid leukemia
umr05223  Non-small cell lung cancer
umr05224  Breast cancer
umr05225  Hepatocellular carcinoma
umr05226  Gastric cancer
umr05230  Central carbon metabolism in cancer
umr05231  Choline metabolism in cancer
umr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
umr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103669422 (NRAS)
   04012 ErbB signaling pathway
    103669422 (NRAS)
   04014 Ras signaling pathway
    103669422 (NRAS)
   04015 Rap1 signaling pathway
    103669422 (NRAS)
   04370 VEGF signaling pathway
    103669422 (NRAS)
   04371 Apelin signaling pathway
    103669422 (NRAS)
   04068 FoxO signaling pathway
    103669422 (NRAS)
   04072 Phospholipase D signaling pathway
    103669422 (NRAS)
   04071 Sphingolipid signaling pathway
    103669422 (NRAS)
   04151 PI3K-Akt signaling pathway
    103669422 (NRAS)
   04150 mTOR signaling pathway
    103669422 (NRAS)
  09133 Signaling molecules and interaction
   04519 Cadherin signaling
    103669422 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103669422 (NRAS)
   04137 Mitophagy - animal
    103669422 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103669422 (NRAS)
   04218 Cellular senescence
    103669422 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103669422 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103669422 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103669422 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103669422 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    103669422 (NRAS)
   04660 T cell receptor signaling pathway
    103669422 (NRAS)
   04662 B cell receptor signaling pathway
    103669422 (NRAS)
   04664 Fc epsilon RI signaling pathway
    103669422 (NRAS)
   04062 Chemokine signaling pathway
    103669422 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103669422 (NRAS)
   04929 GnRH secretion
    103669422 (NRAS)
   04912 GnRH signaling pathway
    103669422 (NRAS)
   04915 Estrogen signaling pathway
    103669422 (NRAS)
   04917 Prolactin signaling pathway
    103669422 (NRAS)
   04921 Oxytocin signaling pathway
    103669422 (NRAS)
   04926 Relaxin signaling pathway
    103669422 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    103669422 (NRAS)
   04919 Thyroid hormone signaling pathway
    103669422 (NRAS)
   04916 Melanogenesis
    103669422 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103669422 (NRAS)
   04726 Serotonergic synapse
    103669422 (NRAS)
   04720 Long-term potentiation
    103669422 (NRAS)
   04730 Long-term depression
    103669422 (NRAS)
   04722 Neurotrophin signaling pathway
    103669422 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103669422 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103669422 (NRAS)
   04213 Longevity regulating pathway - multiple species
    103669422 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103669422 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103669422 (NRAS)
   05206 MicroRNAs in cancer
    103669422 (NRAS)
   05205 Proteoglycans in cancer
    103669422 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    103669422 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103669422 (NRAS)
   05203 Viral carcinogenesis
    103669422 (NRAS)
   05230 Central carbon metabolism in cancer
    103669422 (NRAS)
   05231 Choline metabolism in cancer
    103669422 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103669422 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103669422 (NRAS)
   05225 Hepatocellular carcinoma
    103669422 (NRAS)
   05226 Gastric cancer
    103669422 (NRAS)
   05214 Glioma
    103669422 (NRAS)
   05216 Thyroid cancer
    103669422 (NRAS)
   05221 Acute myeloid leukemia
    103669422 (NRAS)
   05220 Chronic myeloid leukemia
    103669422 (NRAS)
   05218 Melanoma
    103669422 (NRAS)
   05211 Renal cell carcinoma
    103669422 (NRAS)
   05219 Bladder cancer
    103669422 (NRAS)
   05215 Prostate cancer
    103669422 (NRAS)
   05213 Endometrial cancer
    103669422 (NRAS)
   05224 Breast cancer
    103669422 (NRAS)
   05223 Non-small cell lung cancer
    103669422 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103669422 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    103669422 (NRAS)
   05161 Hepatitis B
    103669422 (NRAS)
   05160 Hepatitis C
    103669422 (NRAS)
   05163 Human cytomegalovirus infection
    103669422 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103669422 (NRAS)
   05165 Human papillomavirus infection
    103669422 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103669422 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103669422 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    103669422 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103669422 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103669422 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103669422 (NRAS)
   01522 Endocrine resistance
    103669422 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103669422 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103669422 (NRAS)
   04031 GTP-binding proteins [BR:umr04031]
    103669422 (NRAS)
Membrane trafficking [BR:umr04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    103669422 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103669422 (NRAS)
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103669422 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103669422 (NRAS)
  Exosomal proteins of breast cancer cells
   103669422 (NRAS)
  Exosomal proteins of colorectal cancer cells
   103669422 (NRAS)
GTP-binding proteins [BR:umr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103669422 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 103669422
NCBI-ProteinID: XP_008695968
UniProt: A0A384CMD2
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgtcgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
cgaaaacaggtggttatagacggtgaaacctgtctgttggacatactggatacagctggt
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggtttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt
aagcgagtcaaagattcagatgacgtacctatggtgctagtaggaaataagtgtgatttg
ccaacaaggacagtggacacaaaacaagcccacgaactggccaagagttatgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta
agagaaatacgtcagtaccgaatgaagaaactcaacagcagtgatgatgggactcaaggt
tgtatggggttaccatgtgtggtgatgtaa

DBGET integrated database retrieval system