Ursus maritimus (polar bear): 103669585 Help Entry 103669585         CDS       T03271                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism umr  Ursus maritimus (polar bear) Pathway umr04144   Endocytosis umr04510   Focal adhesion umr05020   Prion disease umr05100   Bacterial invasion of epithelial cells umr05205   Proteoglycans in cancer umr05410   Hypertrophic cardiomyopathy umr05412   Arrhythmogenic right ventricular cardiomyopathy umr05414   Dilated cardiomyopathy umr05416   Viral myocarditis umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103669585 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103669585 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103669585 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103669585 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     103669585 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103669585 (CAV3)    05410 Hypertrophic cardiomyopathy     103669585 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     103669585 (CAV3)    05414 Dilated cardiomyopathy     103669585 (CAV3)    05416 Viral myocarditis     103669585 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103669585 (CAV3) Membrane trafficking [BR:umr04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     103669585 (CAV3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  103669585 NCBI-ProteinID:  XP_008696154 UniProt:  A0A384CNU7 LinkDB All DBs Position Unknown AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaagagcacacagacctggaggcccagattgtcaaggacatccactgcaag gagattgacctggtgaaccgagaccccaagaacattaacgaggatatagtgaaggtggat ttcgaagacgtgatcgcagagcccgtgggcacctacagcttcgacggcgtgtggaaggtg agctacaccaccttcacggtgtccaagtactggtgctaccgcctgctgtccacactgctg ggagtcccgctggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccgtgcattaagagctacctgatcgagatccaatgcatcagccacatc tactccctctgcatccgtaccttctgcaacccgctcttcgccgccctgggccaggtctgc agcaacatcaaggtgatgctgcggaaggaagtgtaa

DBGET integrated database retrieval system