Ursus maritimus (polar bear): 103670147 Help Entry 103670147         CDS       T03271                                  Symbol CCL24 Name (RefSeq) C-C motif chemokine 24   KO K21097   C-C motif chemokine 24 Organism umr  Ursus maritimus (polar bear) Pathway umr04060   Cytokine-cytokine receptor interaction umr04061   Viral protein interaction with cytokine and cytokine receptor umr04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103670147 (CCL24)    04061 Viral protein interaction with cytokine and cytokine receptor     103670147 (CCL24)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     103670147 (CCL24)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103670147 (CCL24) Cytokines and neuropeptides [BR:umr04052]  Cytokines   Chemokines    103670147 (CCL24) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  103670147 NCBI-ProteinID:  XP_008696761 UniProt:  A0A384CPK8 LinkDB All DBs Position Unknown AA seq 119 aa AA seqDB search MAGLATLGASLLLLTLCAHHLDPAGSVSIPSSCCMSFISKTVPEKRVASYQLSSASVCPM AGVIFTTRKGQKFCGDPKQPWVQKITKLVDARQKKASPTVRAMSTKAPVQGSPANTTSI NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcaggccttgcgacccttggggctagcctcctgctcctgaccctgtgtgcccaccac cttgaccctgcaggctctgtgtccatcccctcttcctgctgcatgtccttcatttccaag acagttcccgagaagcgagtggctagctaccagctgtccagtgcgagcgtctgccctatg gcaggagtgatcttcaccaccaggaagggccagaagttctgtggcgaccccaagcagccc tgggtccagaagatcacgaagctggtggatgccaggcagaagaaggcatcccctactgtc agggcaatgagcaccaaagcccctgtgcaggggagccctgccaacaccacctccatctaa

DBGET integrated database retrieval system