Ursus maritimus (polar bear): 103671137 Help Entry 103671137         CDS       T03271                                  Symbol FGF3 Name (RefSeq) fibroblast growth factor 3   KO K04358   fibroblast growth factor Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04151   PI3K-Akt signaling pathway umr04810   Regulation of actin cytoskeleton umr05200   Pathways in cancer umr05207   Chemical carcinogenesis - receptor activation umr05218   Melanoma umr05224   Breast cancer umr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103671137 (FGF3)    04014 Ras signaling pathway     103671137 (FGF3)    04015 Rap1 signaling pathway     103671137 (FGF3)    04020 Calcium signaling pathway     103671137 (FGF3)    04151 PI3K-Akt signaling pathway     103671137 (FGF3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103671137 (FGF3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103671137 (FGF3)    05207 Chemical carcinogenesis - receptor activation     103671137 (FGF3)   09162 Cancer: specific types    05226 Gastric cancer     103671137 (FGF3)    05218 Melanoma     103671137 (FGF3)    05224 Breast cancer     103671137 (FGF3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103671137 (FGF3)    00536 Glycosaminoglycan binding proteins [BR:umr00536]     103671137 (FGF3) Cytokines and neuropeptides [BR:umr04052]  Cytokines   Growth factors (RTK binding)    103671137 (FGF3) Glycosaminoglycan binding proteins [BR:umr00536]  Heparan sulfate / Heparin   Growth factors/receptors    103671137 (FGF3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  103671137 NCBI-ProteinID:  XP_040494722 UniProt:  A0A8M1GIY4 LinkDB All DBs Position Unknown AA seq 226 aa AA seqDB search MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP SGRVNGSLENSAYSILEMTAVEVGIVAIKGLFSGRYLAMNKRGRLYASESYNAECEFVER IHELGYNTYASRLYRTAPSGPGAQRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP RVLDHKDHEMVRLLQSEAGLRGGLPGPPGKGTRPRRQRKRSRGGRA NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atgggcctaatctggctcctgctgctcagcctgctggagcccggctggcccgccgcgggt cccggggcgcgactgcggcgcgatgcgggcggccgcggcggcgtctacgagcacctcggc ggggcgccccggcgccgcaagctctactgcgccaccaagtaccacctgcagctgcacccg agtggccgcgtcaacggcagcctggaaaacagcgcctacagtatcctggagatgacagcg gtggaggtgggcatcgtggccatcaaggggctcttctccgggcggtacctggccatgaac aagagggggcggctctatgcttcggagagctacaacgccgagtgtgagttcgtggagcgg atccacgagctgggctacaacacgtacgcctcgcggctgtaccgcacagcgcccagcggc ccgggggcccagcggcagcccagcgccgagagactgtggtatgtgtccgtgaacggcaag ggcaggccccgcaggggcttcaagacgcgccgcacccagaagtcctccttgttcctgccg cgcgtgctggaccacaaggaccacgagatggtgcggctgctccagagcgaggccgggctc cgcggcggcctgcccgggcccccaggcaagggcaccaggccccggcggcagaggaagcgg agccggggaggccgtgcgtag

DBGET integrated database retrieval system