KEGG   Ursus maritimus (polar bear): 103676238
Entry
103676238         CDS       T03271                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04014  Ras signaling pathway
umr04015  Rap1 signaling pathway
umr04020  Calcium signaling pathway
umr04022  cGMP-PKG signaling pathway
umr04024  cAMP signaling pathway
umr04070  Phosphatidylinositol signaling system
umr04114  Oocyte meiosis
umr04218  Cellular senescence
umr04261  Adrenergic signaling in cardiomyocytes
umr04270  Vascular smooth muscle contraction
umr04371  Apelin signaling pathway
umr04625  C-type lectin receptor signaling pathway
umr04713  Circadian entrainment
umr04720  Long-term potentiation
umr04722  Neurotrophin signaling pathway
umr04728  Dopaminergic synapse
umr04740  Olfactory transduction
umr04744  Phototransduction
umr04750  Inflammatory mediator regulation of TRP channels
umr04910  Insulin signaling pathway
umr04912  GnRH signaling pathway
umr04915  Estrogen signaling pathway
umr04916  Melanogenesis
umr04921  Oxytocin signaling pathway
umr04922  Glucagon signaling pathway
umr04924  Renin secretion
umr04925  Aldosterone synthesis and secretion
umr04970  Salivary secretion
umr04971  Gastric acid secretion
umr05010  Alzheimer disease
umr05012  Parkinson disease
umr05022  Pathways of neurodegeneration - multiple diseases
umr05031  Amphetamine addiction
umr05034  Alcoholism
umr05133  Pertussis
umr05152  Tuberculosis
umr05163  Human cytomegalovirus infection
umr05167  Kaposi sarcoma-associated herpesvirus infection
umr05170  Human immunodeficiency virus 1 infection
umr05200  Pathways in cancer
umr05214  Glioma
umr05417  Lipid and atherosclerosis
umr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:umr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103676238
   04015 Rap1 signaling pathway
    103676238
   04371 Apelin signaling pathway
    103676238
   04020 Calcium signaling pathway
    103676238
   04070 Phosphatidylinositol signaling system
    103676238
   04024 cAMP signaling pathway
    103676238
   04022 cGMP-PKG signaling pathway
    103676238
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103676238
   04218 Cellular senescence
    103676238
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103676238
  09152 Endocrine system
   04910 Insulin signaling pathway
    103676238
   04922 Glucagon signaling pathway
    103676238
   04912 GnRH signaling pathway
    103676238
   04915 Estrogen signaling pathway
    103676238
   04921 Oxytocin signaling pathway
    103676238
   04916 Melanogenesis
    103676238
   04924 Renin secretion
    103676238
   04925 Aldosterone synthesis and secretion
    103676238
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103676238
   04270 Vascular smooth muscle contraction
    103676238
  09154 Digestive system
   04970 Salivary secretion
    103676238
   04971 Gastric acid secretion
    103676238
  09156 Nervous system
   04728 Dopaminergic synapse
    103676238
   04720 Long-term potentiation
    103676238
   04722 Neurotrophin signaling pathway
    103676238
  09157 Sensory system
   04744 Phototransduction
    103676238
   04740 Olfactory transduction
    103676238
   04750 Inflammatory mediator regulation of TRP channels
    103676238
  09159 Environmental adaptation
   04713 Circadian entrainment
    103676238
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103676238
  09162 Cancer: specific types
   05214 Glioma
    103676238
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103676238
   05163 Human cytomegalovirus infection
    103676238
   05167 Kaposi sarcoma-associated herpesvirus infection
    103676238
  09171 Infectious disease: bacterial
   05133 Pertussis
    103676238
   05152 Tuberculosis
    103676238
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103676238
   05012 Parkinson disease
    103676238
   05022 Pathways of neurodegeneration - multiple diseases
    103676238
  09165 Substance dependence
   05031 Amphetamine addiction
    103676238
   05034 Alcoholism
    103676238
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103676238
   05418 Fluid shear stress and atherosclerosis
    103676238
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:umr01009]
    103676238
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:umr04131]
    103676238
   03036 Chromosome and associated proteins [BR:umr03036]
    103676238
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:umr04147]
    103676238
Protein phosphatases and associated proteins [BR:umr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     103676238
Membrane trafficking [BR:umr04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    103676238
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     103676238
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103676238
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EH EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 EF-hand_11 FCaBP_EF-hand TerB DUF5580_M Tsc35 Phage_TAC_12 SUB1_ProdP9 SurA_N_2
Other DBs
NCBI-GeneID: 103676238
NCBI-ProteinID: XP_008703622
UniProt: A0A384D990
LinkDB
Position
Unknown
AA seq 149 aa
MAEQLSEEQVAEFKAAFSRFDTNGDGTINTQELGAVMRDLGEDLSEDELKKLIALVDTDG
DGVISFQEFLAEMVKRMKSWGSEHDMREVFRAFDLDGNGHISVDELKQAMATLGEKLSQE
ELDAMIQEADVDKDGQVNYEEFLRILSQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggccgagcagctgtctgaagaacaggtggccgagttcaaggcggctttctccagattt
gacacgaacggggatggcaccatcaacacccaggagctgggcgccgtgatgcgggacctg
ggcgaggacctgtcggaagacgagctgaagaagctcatcgcactggtggacacggatggc
gacggtgtcatcagcttccaagagttcctggcagagatggtcaagaggatgaagtcctgg
ggcagcgagcacgacatgcgggaggtcttccgtgccttcgacctggacggcaatggccac
atcagtgtggacgagctcaagcaggccatggccacactgggcgagaagctttcccaggag
gagctggacgccatgatccaggaggccgacgtggacaaggacgggcaggtgaactacgag
gagttcttgcgcatcctctcccagaagtga

DBGET integrated database retrieval system