Ursus maritimus (polar bear): 103676671 Help Entry 103676671         CDS       T03271                                  Symbol CAV2 Name (RefSeq) caveolin-2   KO K12958   caveolin 2 Organism umr  Ursus maritimus (polar bear) Pathway umr04144   Endocytosis umr04510   Focal adhesion umr05020   Prion disease umr05100   Bacterial invasion of epithelial cells umr05205   Proteoglycans in cancer umr05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103676671 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103676671 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103676671 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103676671 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     103676671 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103676671 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103676671 (CAV2) Membrane trafficking [BR:umr04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     103676671 (CAV2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  103676671 NCBI-ProteinID:  XP_008704112 UniProt:  A0A384DAN8 LinkDB All DBs Position Unknown AA seq 162 aa AA seqDB search MGLETEKADVQLFMDDDAYSRHSGVDYADLDKFADSGSDRDPHRLNSHLKVGFEDVIAEP VSTHSFDKVWICSHALFEISKYVIYKFLTLFLAIPMAFAAGILFATLSCLHIWIIMPFVK TCLMVLPSVQTIWKSVTDVVIAPLCTSVGRSFSSVSLQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggcagacgtccagctcttcatggacgacgatgcctacagc cgccacagcggcgtcgactacgcggacctggataaattcgctgactcgggctccgaccgg gatccccaccggctcaactcgcatctcaaggtgggcttcgaggatgtgattgcagagccg gtgtctacgcactcctttgacaaagtgtggatttgcagccatgccctctttgaaatcagc aaatacgtgatctacaagttcctgaccttgttcctggctatccccatggccttcgctgca ggaattctctttgccaccctcagctgtctgcacatctggattataatgccttttgtaaag acctgcctaatggtcctgccttcggtgcagacaatatggaagagtgtaacagatgttgtc attgccccattgtgtacaagtgtaggacgcagcttctcttctgtcagcttacaactgagt catgactga

DBGET integrated database retrieval system