Ursus maritimus (polar bear): 103677474 Help Entry 103677474         CDS       T03271                                  Name (RefSeq) ferritin light chain-like   KO K13625   ferritin light chain Organism umr  Ursus maritimus (polar bear) Pathway umr00860   Porphyrin metabolism umr04216   Ferroptosis umr04217   Necroptosis umr04978   Mineral absorption Brite KEGG Orthology (KO) [BR:umr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     103677474  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     103677474    04217 Necroptosis     103677474  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     103677474  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103677474 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103677474 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  103677474 NCBI-ProteinID:  XP_040481982 UniProt:  A0A8M1FJ35 LinkDB All DBs Position Unknown AA seq 134 aa AA seqDB search MEYLELAEEKRKGAERPRKVQNQSSVGALFQDVQKPSQDEWHKTLDTMEAAMVQEKSLNP RLLDLHALGSAPQTQLGDFLEIHFPDEKVKLIKKMDDHVTNLPKMAVPQEWLGESLLERL TLKHGYEPLTASSL NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atggaatatctcgaattggctgaggagaagcgcaaaggcgctgagcgtccccggaaggtg caaaaccagagcagtgttggtgccctgttccaggacgtgcagaagccctcccaagatgag tggcataaaaccctggacaccatggaagctgccatggttcaggagaagagcctgaaccca cgccttttggatctgcatgccctgggttctgccccgcagacccagcttggagacttcctg gagatccacttcccggatgaaaaggtgaaactcatcaagaagatggatgaccacgtgact aacctccccaagatggctgttccccaggaatggctgggtgagtctctcttggaaaggctc accctcaagcatggctacgagcctctgacggccagcagcctttga

DBGET integrated database retrieval system