Ursus maritimus (polar bear): 103678534 Help Entry 103678534         CDS       T03271                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04020   Calcium signaling pathway umr04022   cGMP-PKG signaling pathway umr04114   Oocyte meiosis umr04218   Cellular senescence umr04310   Wnt signaling pathway umr04360   Axon guidance umr04370   VEGF signaling pathway umr04380   Osteoclast differentiation umr04625   C-type lectin receptor signaling pathway umr04650   Natural killer cell mediated cytotoxicity umr04658   Th1 and Th2 cell differentiation umr04659   Th17 cell differentiation umr04660   T cell receptor signaling pathway umr04662   B cell receptor signaling pathway umr04720   Long-term potentiation umr04724   Glutamatergic synapse umr04921   Oxytocin signaling pathway umr04922   Glucagon signaling pathway umr04924   Renin secretion umr05010   Alzheimer disease umr05014   Amyotrophic lateral sclerosis umr05020   Prion disease umr05022   Pathways of neurodegeneration - multiple diseases umr05031   Amphetamine addiction umr05152   Tuberculosis umr05163   Human cytomegalovirus infection umr05166   Human T-cell leukemia virus 1 infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05170   Human immunodeficiency virus 1 infection umr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103678534 (PPP3R2)    04310 Wnt signaling pathway     103678534 (PPP3R2)    04370 VEGF signaling pathway     103678534 (PPP3R2)    04020 Calcium signaling pathway     103678534 (PPP3R2)    04022 cGMP-PKG signaling pathway     103678534 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103678534 (PPP3R2)    04218 Cellular senescence     103678534 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103678534 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     103678534 (PPP3R2)    04660 T cell receptor signaling pathway     103678534 (PPP3R2)    04658 Th1 and Th2 cell differentiation     103678534 (PPP3R2)    04659 Th17 cell differentiation     103678534 (PPP3R2)    04662 B cell receptor signaling pathway     103678534 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     103678534 (PPP3R2)    04921 Oxytocin signaling pathway     103678534 (PPP3R2)    04924 Renin secretion     103678534 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     103678534 (PPP3R2)    04720 Long-term potentiation     103678534 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     103678534 (PPP3R2)    04380 Osteoclast differentiation     103678534 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103678534 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103678534 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     103678534 (PPP3R2)    05163 Human cytomegalovirus infection     103678534 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     103678534 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     103678534 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     103678534 (PPP3R2)    05014 Amyotrophic lateral sclerosis     103678534 (PPP3R2)    05020 Prion disease     103678534 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     103678534 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     103678534 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103678534 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:umr01009]     103678534 (PPP3R2) Protein phosphatases and associated proteins [BR:umr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103678534 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  103678534 NCBI-ProteinID:  XP_008706119 UniProt:  A0A384DGZ9 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPEEMCSHFNSDEIKRLGKRFKKLDLDSSGALSLEEFMSLPELQQNPLVQRVVD VFDTDGNGEVDFKEFILGTSQFSVRGDEEQKLRFAFSIYDIDKDGYISNGELFQVLKLMV GNNLKDWQLQQLVDKTIIILDQDGDGKISFEEFCTVVGGLEIHKKLVVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagttacccggaggaaatgtgctcccacttcaactctgacgaaatc aaaaggctgggcaagaggtttaagaagctggacttggactcttcgggcgcactgagcctg gaggagttcatgtccctgcccgagctgcagcagaatccgttggtgcagcgagtggtcgac gtcttcgacaccgacggcaacggagaagtggacttcaaggagttcatcctggggacctcc cagttcagcgtcaggggggacgaggagcaaaagttgaggtttgccttcagcatctacgac atcgataaagacggctacatttccaatggggagctcttccaggtgctgaagctgatggtg ggcaacaacctgaaggactggcagctgcagcagctcgtggacaaaaccatcatcatcctg gaccaggatggagacggcaaaatatccttcgaggaattctgcactgtggtcggaggcctg gagatccacaagaagttggtggtgatagtgtga

DBGET integrated database retrieval system