Ursus maritimus (polar bear): 103678855 Help Entry 103678855         CDS       T03271                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05202   Transcriptional misregulation in cancer umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103678855  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103678855   09163 Immune disease    05322 Systemic lupus erythematosus     103678855   09165 Substance dependence    05034 Alcoholism     103678855  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     103678855   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103678855 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103678855 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103678855 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  103678855 NCBI-ProteinID:  XP_008706493 UniProt:  A0A384DHH8 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcacgtaccaagcagaccgcgcggaagtctacgggaggcaaagcgccgcgcaagcag ctggccactaaagtggcccgcaagagcgcaccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcaccgtggccctgcgcgagatccggcgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagaggctggtgcgtgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaagaagcgtgcgaggcgtac ctggtggggctcttcgaggacaccaacctgtgtgccatccacgccaagcgcgtcaccatc atgccgaaggacatccagctggcgcgccgcatccgcggggagcgtgcttaa

DBGET integrated database retrieval system