Ursus maritimus (polar bear): 103679469 Help Entry 103679469         CDS       T03271                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism umr  Ursus maritimus (polar bear) Pathway umr04360   Axon guidance umr04666   Fc gamma R-mediated phagocytosis umr04810   Regulation of actin cytoskeleton umr05133   Pertussis umr05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:umr00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103679469 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagocytosis     103679469 (CFL1)   09158 Development and regeneration    04360 Axon guidance     103679469 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103679469 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     103679469 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103679469 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:umr04812]     103679469 (CFL1)    04147 Exosome [BR:umr04147]     103679469 (CFL1) Membrane trafficking [BR:umr04131]  Others   Actin-binding proteins    Others     103679469 (CFL1) Cytoskeleton proteins [BR:umr04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      103679469 (CFL1) Exosome [BR:umr04147]  Exosomal proteins   Proteins found in most exosomes    103679469 (CFL1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  103679469 NCBI-ProteinID:  XP_008707230 UniProt:  A0A384DKB2 LinkDB All DBs Position Unknown AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggcgtggcagtctctgatggcgtcatcaaagtgttcaatgacatgaaggtg cgcaagtcctcgacaccagaggaggtgaagaagcgcaagaaggcggtacttttctgcctg agcgaggataagaagaacatcatcctggaggagggcaaggagatcctggtaggtgatgtg ggccagactgtagacgacccctacgccacctttgtcaagatgctgccagacaaggactgc cgctacgccctctacgacgcaacctatgagaccaaggagagcaagaaggaggacttggtg tttatcttctgggcacctgagtctgcaccccttaagagcaaaatgatttatgccagctcc aaggatgccatcaagaaaaagctgacggggatcaagcatgaattacaagcaaactgctac gaggaggtcaaggaccgctgcaccctggcagagaaactggggggcagtgctgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system