Ursus maritimus (polar bear): 103680385 Help Entry 103680385         CDS       T03271                                  Name (RefSeq) interferon alpha-1/2-like   KO K05414   interferon alpha Organism umr  Ursus maritimus (polar bear) Pathway umr04060   Cytokine-cytokine receptor interaction umr04151   PI3K-Akt signaling pathway umr04217   Necroptosis umr04620   Toll-like receptor signaling pathway umr04621   NOD-like receptor signaling pathway umr04622   RIG-I-like receptor signaling pathway umr04623   Cytosolic DNA-sensing pathway umr04630   JAK-STAT signaling pathway umr04650   Natural killer cell mediated cytotoxicity umr04936   Alcoholic liver disease umr05152   Tuberculosis umr05160   Hepatitis C umr05161   Hepatitis B umr05162   Measles umr05163   Human cytomegalovirus infection umr05164   Influenza A umr05165   Human papillomavirus infection umr05167   Kaposi sarcoma-associated herpesvirus infection umr05168   Herpes simplex virus 1 infection umr05169   Epstein-Barr virus infection umr05170   Human immunodeficiency virus 1 infection umr05171   Coronavirus disease - COVID-19 umr05200   Pathways in cancer umr05320   Autoimmune thyroid disease umr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103680385    04151 PI3K-Akt signaling pathway     103680385   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103680385  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103680385  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103680385    04621 NOD-like receptor signaling pathway     103680385    04622 RIG-I-like receptor signaling pathway     103680385    04623 Cytosolic DNA-sensing pathway     103680385    04650 Natural killer cell mediated cytotoxicity     103680385  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103680385   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103680385    05161 Hepatitis B     103680385    05160 Hepatitis C     103680385    05171 Coronavirus disease - COVID-19     103680385    05164 Influenza A     103680385    05162 Measles     103680385    05168 Herpes simplex virus 1 infection     103680385    05163 Human cytomegalovirus infection     103680385    05167 Kaposi sarcoma-associated herpesvirus infection     103680385    05169 Epstein-Barr virus infection     103680385    05165 Human papillomavirus infection     103680385   09171 Infectious disease: bacterial    05152 Tuberculosis     103680385   09163 Immune disease    05320 Autoimmune thyroid disease     103680385   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103680385   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103680385  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103680385 Cytokines and neuropeptides [BR:umr04052]  Cytokines   Interferons    103680385 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Spo16_N Motif Other DBs NCBI-GeneID:  103680385 NCBI-ProteinID:  XP_008708139 UniProt:  A0A384DN00 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MALPFSFLVALVVLSGNSLCSLGCDLPQNRGLFAWRALMLLGQMKRMSASSCDGYTRDFA FPKEVVDGKQLQKAQALSVVHVMNQKIFHVFCTEPSSAAWNTTLLEEFCSGLSEQLSVLE ACPMQAAGVGETPGMNVDSILRNYFQRISLYLQEKQYSLCAWETVRAEITSSLFSSTILQ EGLRRKK NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggccctgcccttctccttcttggtggccctggtggtgctcagcggcaactctctctgc tctctgggctgtgacctgcctcagaaccgtggcctgtttgcctggagggccttgatgctc ctgggacaaatgaagagaatgtctgctagctcttgtgacgggtacacacgtgactttgcc ttccccaaggaggtggttgatggcaagcagttgcagaaggctcaagccctctcggtcgtg catgtgatgaaccagaagatcttccacgtcttctgcacagagccctcatctgctgcttgg aacacgaccctcctagaggaattctgctcgggactttctgagcagctgagcgtcctggaa gcctgtcccatgcaggcggcgggagtgggagagactcctggcatgaatgtggactccatc ctgaggaactacttccaaagaatctccctctacctgcaagagaagcaatacagcctttgt gcctgggagactgtcagagcagaaatcacgagctccttgttttcatcaacgatcttgcaa gaaggactaaggcgcaagaaatga

DBGET integrated database retrieval system