Ursus maritimus (polar bear): 103682323 Help Entry 103682323         CDS       T03271                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism umr  Ursus maritimus (polar bear) Pathway umr04060   Cytokine-cytokine receptor interaction umr04061   Viral protein interaction with cytokine and cytokine receptor umr04064   NF-kappa B signaling pathway umr04668   TNF signaling pathway umr04940   Type I diabetes mellitus umr05166   Human T-cell leukemia virus 1 infection umr05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103682323 (LTA)    04668 TNF signaling pathway     103682323 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103682323 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     103682323 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103682323 (LTA)    05168 Herpes simplex virus 1 infection     103682323 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103682323 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     103682323 (LTA) Cytokines and neuropeptides [BR:umr04052]  Cytokines   Tumor necrosis fators    103682323 (LTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  103682323 NCBI-ProteinID:  XP_008710133 UniProt:  A0A384DT06 A0A452UI06 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MTPPGRLYLLRVCSAPPLLLLGLLLALPPEAQGLPGVGVSPSAARTAYQHPQKHFAPGTL KPAAHLIGDPSTQSSLRWRANTDRAFLRHGFSLSNNSLLVPTSGLYFVYSQVVFSGEGCF PKATPTPLYLAHEVQLFSSQYPFHVPLLSAQKSVCPGPQGPWVRSVYQGAVFLLTQGDQL STHTDGVSHLLLSPSSVFFGAFAL NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgacacctcctggacggctctacctcctgagggtgtgcagcgccccccccctcctcctc ctggggctgctgctggccctgccgcctgaggcccaggggcttcctggggtcggtgtctca ccctcagctgcccggactgcctaccagcaccctcagaagcacttcgcaccaggcaccctc aaaccagctgctcatcttattggagaccccagcacccagagctcactgcgctggagagca aacacggatcgtgccttcctccgacatggcttctctttgagcaacaattccctcctggtt cccaccagtggcctctactttgtctactcccaggtggtcttctctggagaaggctgcttc cccaaggccacccccacccctctctacctggcccatgaggtccagctcttctcctcccag taccccttccacgtgcctctcctcagtgctcagaagtctgtgtgcccagggccacaggga ccttgggtgcgctctgtgtaccagggagcggtgttcctgctcacccagggagatcagctc tccactcacacggatggtgtctcccacctactcctcagccccagtagtgtcttctttgga gcctttgctctgtag

DBGET integrated database retrieval system