Ursus maritimus (polar bear): 103682516 Help Entry 103682516         CDS       T03271                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism umr  Ursus maritimus (polar bear) Pathway umr04014   Ras signaling pathway umr04137   Mitophagy - animal umr04144   Endocytosis umr04145   Phagosome umr04148   Efferocytosis umr04962   Vasopressin-regulated water reabsorption umr05132   Salmonella infection umr05146   Amoebiasis umr05152   Tuberculosis Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103682516 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103682516 (RAB5B)    04145 Phagosome     103682516 (RAB5B)    04137 Mitophagy - animal     103682516 (RAB5B)    04148 Efferocytosis     103682516 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103682516 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103682516 (RAB5B)    05152 Tuberculosis     103682516 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     103682516 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:umr04131]     103682516 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     103682516 (RAB5B)    04031 GTP-binding proteins [BR:umr04031]     103682516 (RAB5B) Membrane trafficking [BR:umr04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     103682516 (RAB5B)  Endosome - Lysosome transport     103682516 (RAB5B) Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103682516 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    103682516 (RAB5B)   Exosomal proteins of colorectal cancer cells    103682516 (RAB5B)   Exosomal proteins of melanoma cells    103682516 (RAB5B) GTP-binding proteins [BR:umr04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     103682516 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  103682516 NCBI-ProteinID:  XP_008710346 UniProt:  A0A384DTH5 LinkDB All DBs Position Unknown AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAACRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaattggtcctgctgggtgaatctgcagtggggaagtctagcctggtattacgtttt gtcaaagggcagttccatgagtaccaagagagcaccattggagctgccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaggaa cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccttggcggggaacaaagctgaccttgccaataag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcatgccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system