Ursus maritimus (polar bear): 121100999 Help Entry 121100999         CDS       T03271                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism umr  Ursus maritimus (polar bear) Brite KEGG Orthology (KO) [BR:umr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:umr03029]     121100999 (MTLN) Mitochondrial biogenesis [BR:umr03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     121100999 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom CheW_CheR_link Motif Other DBs NCBI-GeneID:  121100999 NCBI-ProteinID:  XP_040479117 UniProt:  A0A8M1FB66 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search MADVSERTLQLSVLVAFASGVLVGWQANRLRRRYLDWRKRRLQDKLATTQKKLDLA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggacgtgtccgagcggacgctgcagctgtctgtgctggtggccttcgcgtccgga gtgctcgtgggctggcaggcgaaccggctacggaggcgctacctggactggaggaagcgg aggctgcaggacaagctggcgacgactcagaagaagctggacctggcctga

DBGET integrated database retrieval system