Ursus maritimus (polar bear): 121102568 Help Entry 121102568         CDS       T03271                                  Name (RefSeq) late histone H2B.L4-like   KO K11252   histone H2B Organism umr  Ursus maritimus (polar bear) Pathway umr04613   Neutrophil extracellular trap formation umr05034   Alcoholism umr05203   Viral carcinogenesis umr05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:umr00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     121102568  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     121102568   09163 Immune disease    05322 Systemic lupus erythematosus     121102568   09165 Substance dependence    05034 Alcoholism     121102568  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:umr03036]     121102568   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:umr04147]     121102568 Chromosome and associated proteins [BR:umr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     121102568 Exosome [BR:umr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    121102568 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa TAF Motif Other DBs NCBI-GeneID:  121102568 NCBI-ProteinID:  XP_040485486 UniProt:  A0A8M1FQ36 LinkDB All DBs Position X AA seq 145 aa AA seqDB search MAEPGCETSSEESVGTEEPSAADPKSAKQKQPRRRGRGRGRSRGRLGRRRRPHPDSFATY FPRVLKQVHEGLSLSKKAVSVMDSFVKDIFERIADEAARLARSTKRSTISSREIQTAVRL LLPGEIGKHAVSEATKAVIRFQRRE NT seq 438 nt NT seq  +upstreamnt  +downstreamnt atggctgagcctggctgtgagacctcttccgaggaaagcgtgggcacggaggagccctcg gcagccgacccgaagagcgcgaagcagaagcagccgaggcgccgcggccgcggccgcggt cgcagtcgcggtcgcctcggccgccgccgccgcccccaccccgacagtttcgccacctac ttccccagggttctgaagcaggtgcacgagggcctgagcctctcgaagaaggccgtgagc gtcatggattcgttcgttaaggacatcttcgagcgcatcgccgacgaggccgctcgtctg gctcgctccaccaagcgctccaccatcagctccagggagatccagacagccgtgcgcctg ctgctgcctggggagatcggcaagcacgccgtgtccgaggccaccaaggccgtcatcagg ttccagagacgcgaatga

DBGET integrated database retrieval system