Ursus maritimus (polar bear): 121102598 Help Entry 121102598         CDS       T03271                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism umr  Ursus maritimus (polar bear) Pathway umr04010   MAPK signaling pathway umr04014   Ras signaling pathway umr04015   Rap1 signaling pathway umr04020   Calcium signaling pathway umr04151   PI3K-Akt signaling pathway umr04810   Regulation of actin cytoskeleton umr05200   Pathways in cancer umr05207   Chemical carcinogenesis - receptor activation umr05218   Melanoma umr05224   Breast cancer umr05226   Gastric cancer Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     121102598 (FGF22)    04014 Ras signaling pathway     121102598 (FGF22)    04015 Rap1 signaling pathway     121102598 (FGF22)    04020 Calcium signaling pathway     121102598 (FGF22)    04151 PI3K-Akt signaling pathway     121102598 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     121102598 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121102598 (FGF22)    05207 Chemical carcinogenesis - receptor activation     121102598 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     121102598 (FGF22)    05218 Melanoma     121102598 (FGF22)    05224 Breast cancer     121102598 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     121102598 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:umr00536]     121102598 (FGF22) Cytokines and neuropeptides [BR:umr04052]  Cytokines   Growth factors (RTK binding)    121102598 (FGF22) Glycosaminoglycan binding proteins [BR:umr00536]  Heparan sulfate / Heparin   Growth factors/receptors    121102598 (FGF22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  121102598 NCBI-ProteinID:  XP_040485744 UniProt:  A0A8M1G011 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGGRLWLGLAWLLLARPPGAAGTPGSPRRPRSYPHLEGDVRWRRLFSSTHFFLRVDPSGR VQGTRWRHGADSIIEIRSIRVGVVALKAVHTGFYVAMNRRGHLYGSRVYTAHCRFQERIE ENGYNTYASLRWRHHGRPMFLALDGQGAPRRGGRTQRHHLSTHFLPVLVS NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggcggccgcctgtggctgggcctggcgtggctgctgctggcacggccgcccggcgcc gcggggaccccgggcagtccgcggagaccgcgcagctacccacacctggagggcgacgtg cgctggcggcgcctcttctcctccacccacttcttcctgcgcgtggaccccagcggccgc gtgcagggcacccgctggcgccacggcgccgacagcatcattgagatccgctccatccgc gtgggcgtcgtggccctcaaggctgtgcacaccggcttctacgtggccatgaaccgcagg ggccacctctacgggtcgcgggtctacactgcccactgcaggttccaggagcgcatcgag gagaacggctacaacacctacgcctcgctccgctggcgtcaccatggtcggcccatgttc ctggcgctggatgggcagggggccccgcggcgtggtggccggacacagcggcaccaccta tccacccacttcctgcctgtcctggtctcctga

DBGET integrated database retrieval system