Ursus maritimus (polar bear): 121104347 Help Entry 121104347         CDS       T03271                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   prolactin-releasing peptide Organism umr  Ursus maritimus (polar bear) Pathway umr04080   Neuroactive ligand-receptor interaction umr04081   Hormone signaling Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121104347 (PRLH)    04081 Hormone signaling     121104347 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     121104347 (PRLH) Cytokines and neuropeptides [BR:umr04052]  Neuropeptides   GPCR binding    121104347 (PRLH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP LEAP-2 Motif Other DBs NCBI-GeneID:  121104347 NCBI-ProteinID:  XP_040492992 UniProt:  A0A452U6A8 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MKALQAWLVCLLLLGLALKGAAGQAHQHSMEIRTPNLDPAWYTGRRIRPVGRFGRRREAL GDAEKQSLWHQPACFPLQGGAQPAQDG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaggctttgcaggcctggctcgtgtgcctgctgctgctgggcctggccctgaagggg gccgccggccaagcccaccagcattccatggagatccgcacccccaacctcgatcctgcc tggtacacaggccgcagaatcaggcctgtgggccgcttcggccggaggagagaggccctg ggggatgcagagaagcagagcctctggcaccagcccgcctgcttccccctgcaaggaggc gcccagcccgcccaggatgggtga

DBGET integrated database retrieval system