Ursus maritimus (polar bear): 121104541 Help Entry 121104541         CDS       T03271                                  Symbol OXT Name (RefSeq) oxytocin-neurophysin 1   KO K05243   oxytocin-neurophysin 1 Organism umr  Ursus maritimus (polar bear) Pathway umr04024   cAMP signaling pathway umr04080   Neuroactive ligand-receptor interaction umr04081   Hormone signaling umr04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:umr00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     121104541 (OXT)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     121104541 (OXT)    04081 Hormone signaling     121104541 (OXT)  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     121104541 (OXT)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:umr04052]     121104541 (OXT) Cytokines and neuropeptides [BR:umr04052]  Neuropeptides   GPCR binding    121104541 (OXT) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_5 Hormone_4 Motif Other DBs NCBI-GeneID:  121104541 NCBI-ProteinID:  XP_040493761 UniProt:  A0A8M1GDN0 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search MTGPGLACCLLGLLALTSACYIQNCPLGGKRAALDLDVRQCLPCGPGGKGRCFGPSICCG DELGCFVGTAEALRCQEENYLPSPCQSGHQPCGSGGRCAAAGICCSPDGCRADPACDPEA AFSQR NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgaccggccccggcctcgcctgctgcctgctcggcctcctggcgctgacctccgcctgc tacatccagaactgcccgctgggcggcaagagggccgcgctggacctcgacgtgcgccag tgtctcccctgcggccccgggggcaaagggcgctgcttcgggcccagcatctgctgcggc gacgagctgggctgcttcgtgggcacggccgaggcgctgcgctgccaggaggagaactac ctgccgtcgccctgccagtcgggccaccagccgtgcgggagcgggggccgctgcgccgcc gccggcatctgctgcagcccggacggctgccgcgccgaccccgcctgcgaccccgaggcc gccttctcccagcgctga

DBGET integrated database retrieval system