Undibacterium sp. KW1: UNDKW_0801 Help Entry UNDKW_0801        CDS       T08678                                  Name (GenBank) hypothetical protein   KO K03586   cell division protein FtsL Organism und  Undibacterium sp. KW1 Brite KEGG Orthology (KO) [BR:und00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:und03036]     UNDKW_0801 Chromosome and associated proteins [BR:und03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     UNDKW_0801 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL Motif Other DBs NCBI-ProteinID:  BBB59074 UniProt:  A0A6N4SYJ3 LinkDB All DBs Position 883552..883827 Genome browser AA seq 91 aa AA seqDB search MSTRWNIILAAALIACALSLINAQYQARRLFIELEREQSLSKQYELQWTQLKLDQSTYGK HARIEATAARELNMVAVTPERTQYLKAVEAK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgagtacccgctggaatattatcctggccgcggcattgattgcctgtgccctgtcattg attaatgcgcagtatcaggcacgtcgcctgtttatagagctggagcgggagcaaagttta agcaaacaatacgaattgcaatggacgcaactgaaactcgatcaatccacctacggcaag catgcgcgcatagaagcaacggcagcgcgtgaattgaacatggttgctgtgacccctgaa cgcacgcagtacctcaaagcagtggaggcaaaatga

DBGET integrated database retrieval system