Undibacterium sp. YM2: UNDYM_5509 Help Entry UNDYM_5509        CDS       T10101                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism uny  Undibacterium sp. YM2 Pathway uny00190   Oxidative phosphorylation uny01100   Metabolic pathways Module uny_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:uny00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     UNDYM_5509 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:uny00194]     UNDYM_5509 (atpE) Photosynthesis proteins [BR:uny00194]  Photosystem and electron transport system   F-type ATPase [OT]    UNDYM_5509 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Romo1 Motif Other DBs NCBI-ProteinID:  BBB69762 UniProt:  A0A809QLA6 LinkDB All DBs Position complement(6009544..6009786) Genome browser AA seq 80 aa AA seqDB search MTNVAFVALACGLIIGLGALGACIGIAMMGGKYLEASARQPELMEKLQGKMLLLAGLIDA AFIIGVGIAMFFATANPFKG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgactaacgtcgctttcgttgcattggcttgtggtttgatcatcggtttgggcgctttg ggtgcttgtatcggtatcgctatgatgggtggtaaatatctggaagcgtctgcacgtcaa ccagaattgatggaaaaactgcaaggtaaaatgttgttgctggctggtctgatcgatgct gcgttcattatcggtgttggtatcgccatgttcttcgcaactgcaaacccattcaaaggc taa

DBGET integrated database retrieval system