Usitatibacter palustris: DSM104440_00636 Help Entry DSM104440_00636   CDS       T06995                                  Symbol ftsL Name (GenBank) Cell division protein FtsL   KO K03586   cell division protein FtsL Organism upl  Usitatibacter palustris Brite KEGG Orthology (KO) [BR:upl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:upl03036]     DSM104440_00636 (ftsL) Chromosome and associated proteins [BR:upl03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     DSM104440_00636 (ftsL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL FtsL_2 Motif Other DBs NCBI-ProteinID:  QJR13846 UniProt:  A0A6M4H2U4 LinkDB All DBs Position 607088..607354 Genome browser AA seq 88 aa AA seqDB search MSLLLLVLLVACALGTITAQHRARKSFVELEAEQVAAKKLEEEFTQLQLEQSTWSTHKRV EAVASKQLGMKAPDAASTMIVSPEAKAP NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgagcctgctcctgctcgtcctgctggtggcctgcgccctgggaaccatcaccgcgcag catcgcgcccggaaatcgttcgtcgagctcgaggccgagcaggtcgcggccaagaagctc gaggaagagttcacgcagctgcagctcgagcaaagcacgtggtccacgcacaagcgcgtg gaggcggtcgcttcgaagcagctcggcatgaaggccccggatgcggcgagcacgatgatc gtgtcgcccgaagcgaaggcgccatga

DBGET integrated database retrieval system