KEGG   Usitatibacter palustris: DSM104440_01853
Entry
DSM104440_01853   CDS       T06995                                 
Symbol
cheB_2
Name
(GenBank) Protein-glutamate methylesterase/protein-glutamine glutaminase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
upl  Usitatibacter palustris
Pathway
upl02020  Two-component system
upl02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:upl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSM104440_01853 (cheB_2)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    DSM104440_01853 (cheB_2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:upl02022]
    DSM104440_01853 (cheB_2)
   02035 Bacterial motility proteins [BR:upl02035]
    DSM104440_01853 (cheB_2)
Enzymes [BR:upl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DSM104440_01853 (cheB_2)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     DSM104440_01853 (cheB_2)
Two-component system [BR:upl02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   DSM104440_01853 (cheB_2)
Bacterial motility proteins [BR:upl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DSM104440_01853 (cheB_2)
SSDB
Motif
Pfam: CheB_methylest Response_reg
Other DBs
NCBI-ProteinID: QJR15037
UniProt: A0A6M4HAG4
LinkDB
Position
1896830..1897897
AA seq 355 aa
MNPIRVLIVDDSRMIRDVLTDILKEQPGIEVVGAAADAFEARDMIRDLKPDVVTLDVEMP
RMNGLEFLDKLMRARPTPVVMISAFTERGSEVTFRALELGAVEFVTKPKLHEQTPDDYGT
LIAEKIRAAKSARLRAPRRVETTLPTEAAVVQKRPVPRGIKTSDKLIAVGASTGGTEAIK
EFLVGMPEDCPGIVIVQHMPENFTRMFAERLDGLCKIRVKEAEHNDPILPGHAYIAPGGK
HLWVKRDEGALIAKLSNEPPMTLHRPAVDFLFMSCAKYVGKDCIGVIMTGMGKDGTRGML
EMRDAGAYNIAQDEATSVIFGMPREAIEAGAVHEVAPLTRLRDRALARLTSKERA
NT seq 1068 nt   +upstreamnt  +downstreamnt
gtgaacccgatccgcgtcctcatcgtcgacgactcgcgcatgatccgcgacgtcctcacc
gacatcctcaaggaacagccgggcatcgaggtcgtgggcgccgcggccgacgccttcgag
gcgcgcgacatgatccgcgacctgaagcccgacgtggtgacgctcgatgtcgagatgccg
cgcatgaacggcctggaattcctcgacaagctcatgcgggcgcggcccacccccgtggtg
atgatctccgcgttcaccgagcgcggctcggaagtgaccttccgtgcgctcgagcttggc
gcggtcgagttcgtcaccaagcccaagctccacgagcagacgcccgacgactacggcacg
ctgatcgccgagaagatccgcgcggccaagagcgcgcgactgcgcgccccccgccgggtc
gagaccacgttgcccaccgaggcggccgtggtgcagaagcgcccggtgccgcgcggcatc
aagacctccgacaagctcatcgccgtgggcgcatccaccggcggcacggaagcgatcaag
gaattcctcgtgggcatgcccgaggattgccccggcatcgtgatcgtgcagcacatgccc
gagaacttcacgcgcatgttcgccgagcgcctcgacggcctgtgcaagatccgcgtgaag
gaagccgagcacaacgacccgatccttccgggccacgcgtacatcgcgcccggcggcaag
cacctgtgggtgaagcgcgacgaaggcgcgctgatcgcgaagctctccaacgagccgccg
atgacgctgcatcgtcccgcggtcgacttcctcttcatgtcgtgcgcgaagtacgtcggc
aaggattgcatcggcgtgatcatgaccggcatgggcaaggacggcacgcgcggcatgctc
gagatgcgcgacgccggcgcctacaacatcgcccaggacgaagcgacctcggtgatcttc
ggcatgccccgcgaagcgatcgaggcgggtgccgtgcatgaagtggcccccctcacgcgc
ctgcgcgaccgcgcgctcgcacgcctcaccagcaaggagcgcgcatga

DBGET integrated database retrieval system