Usitatibacter palustris: DSM104440_02546 Help Entry DSM104440_02546   CDS       T06995                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism upl  Usitatibacter palustris Pathway upl01100   Metabolic pathways upl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:upl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM104440_02546 (acpP_2)    00074 Mycolic acid biosynthesis     DSM104440_02546 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM104440_02546 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QJR15720 UniProt:  A0A6M4H820 LinkDB All DBs Position 2639592..2639861 Genome browser AA seq 89 aa AA seqDB search MDHTIDIEQELASLLVETLHLEGVAANQIDPVAPLFGEGLGLDSLDMLELSMAIEQKYGI KLRSDDPDNRTIFASLRSLGQYVQKNGRA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atggaccacaccatcgacatcgagcaggagctcgccagcctgctcgtggagacgctgcac ctcgagggtgtggccgcgaaccagatcgatcccgtggcgccgttgttcggcgaggggctc ggcctcgattcgctcgacatgctcgagctgtcgatggcgatcgaacagaaatacggcatc aagctgcgctcggacgacccggacaaccgcacgatcttcgcgtcgttgcgcagccttggc cagtatgtccagaagaacggccgggcctga

DBGET integrated database retrieval system