KEGG   Usitatibacter palustris: DSM104440_03654
Entry
DSM104440_03654   CDS       T06995                                 
Symbol
phoB
Name
(GenBank) Phosphate regulon transcriptional regulatory protein PhoB
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
upl  Usitatibacter palustris
Pathway
upl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:upl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSM104440_03654 (phoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:upl02022]
    DSM104440_03654 (phoB)
Two-component system [BR:upl02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   DSM104440_03654 (phoB)
SSDB
Motif
Pfam: Response_reg Trans_reg_C cREC_REC
Other DBs
NCBI-ProteinID: QJR16818
UniProt: A0A6M4HDK7
LinkDB
Position
3794363..3795049
AA seq 228 aa
MPASILVVEDERAIQELIAINLEQSGQRAVRADSAEQALELIQTELPDLILLDWMLPGQS
GLELARRLRGDARTKALPIIMLTARGEEADKLRGLETGADDYITKPFSLRELQARIKAVL
RRRAPEITDDVIEYHGLKLDPASHRVTGRGKDLTMGPTEFRLLHFFLTHPERVYTRTQLL
DHVWGDHVFIEERTVDVHIRRLRAALTKSGQQTFVQTIRGSGYRFSKA
NT seq 687 nt   +upstreamnt  +downstreamnt
atgcctgccagcattctcgtcgtcgaagacgaacgcgcgatccaggagctgatcgcgatc
aacctcgagcagtcgggtcagcgcgccgtgcgcgccgactcagccgagcaggcgttggaa
ctcatccagacggagttgcccgacctcatcctgctcgactggatgcttcccgggcaaagc
ggcctcgagctcgcgcgccgcctgcgcggcgacgcgcgcacgaaggccctgccgatcatc
atgctcaccgcccgcggcgaggaagccgacaagctgcgcggcctcgaaaccggcgcggac
gactacatcacgaagcccttctccctgcgcgagctccaggcgcgcatcaaggccgtgctt
cgccgccgcgcgcccgagatcaccgatgacgtgatcgagtaccacggcctcaagctcgat
ccggcttcgcatcgcgtgaccggccgcggcaaggacctgacgatgggtccgacggaattc
cgcctgctgcacttcttcctcacgcatccggagcgcgtgtacacccgcacgcagctgctc
gaccatgtgtggggcgatcacgtgttcatcgaggagcgcacggtggacgtgcacatccgg
aggctgcgcgccgcgctcacgaagagcgggcagcagaccttcgtccagaccatccgcggc
tcgggatatcgcttctccaaggcatga

DBGET integrated database retrieval system