Undibacterium parvum: EJN92_08755 Help Entry EJN92_08755       CDS       T05754                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism upv  Undibacterium parvum Pathway upv01100   Metabolic pathways upv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:upv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EJN92_08755    00074 Mycolic acid biosynthesis     EJN92_08755   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EJN92_08755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD RPN6_C_helix Motif Other DBs NCBI-ProteinID:  AZP14493 UniProt:  A0A3S9HQU2 LinkDB All DBs Position complement(2015172..2015417) Genome browser AA seq 81 aa AA seqDB search MSKEELYAWVVDLLAEMFELDKADMRPESNLYADLDIDSIDAVDLAVKLKQMTGKRLQPE VFKTIRTISDVVDALSALAPE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtaaagaagagctgtatgcttgggtggtggatttgctggctgaaatgtttgagctg gataaggcggatatgcggccagagtctaacctatatgccgatctcgatatcgacagcatc gatgcggtcgatctggcggtgaaattaaaacaaatgactggcaaacgtctgcaaccggaa gtgttcaagaccatacgcactatcagcgatgtggtcgatgcattaagcgctttggcaccg gagtaa

DBGET integrated database retrieval system