Uncinocarpus reesii: UREG_00754 Help Entry UREG_00754        CDS       T01132                                  Name (RefSeq) cell division control protein 42   KO K04393   cell division control protein 42 Organism ure  Uncinocarpus reesii Pathway ure04011   MAPK signaling pathway - yeast ure04144   Endocytosis ure04517   IgSF CAM signaling ure04518   Integrin signaling ure05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ure00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     UREG_00754   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     UREG_00754    04518 Integrin signaling     UREG_00754  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     UREG_00754  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     UREG_00754  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ure04131]     UREG_00754    03036 Chromosome and associated proteins [BR:ure03036]     UREG_00754   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ure04147]     UREG_00754    04031 GTP-binding proteins [BR:ure04031]     UREG_00754 Membrane trafficking [BR:ure04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     UREG_00754  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     UREG_00754   Macropinocytosis    Ras GTPases     UREG_00754 Chromosome and associated proteins [BR:ure03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     UREG_00754 Exosome [BR:ure04147]  Exosomal proteins   Exosomal proteins of microglial cells    UREG_00754   Exosomal proteins of breast milk    UREG_00754 GTP-binding proteins [BR:ure04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     UREG_00754 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  8443700 NCBI-ProteinID:  XP_002541240 UniProt:  C4JDJ4 LinkDB All DBs AA seq 194 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVRHHCPGVPCLIVGTQTD LRDDLAVREKLSKQKMAPVRKEDGERMARELGAVKYVECSALTQYKLKDVFDEAIVAALE PPSTRKKSRVCKIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggttgttgctaccatcaaatgtgttgtcgtcggcgatggagctgttggcaagacctgt ctcctaatctcatacacaacaaacaagttcccatccgaatacgtcccgaccgtcttcgat aactatgctgttactgtcatgatcggagatgaaccatatactcttggccttttcgatact gctggtcaggaggactacgatcgtcttcgcccactttcgtatccgcagacagatgtcttc ctcgtctgtttctccgtgacctctcctgcctcattcgaaaacgttcgcgagaaatggttc ccggaagtccgtcatcactgcccaggtgttccttgcttgattgttgggacccagaccgat ttgcgtgatgatcttgctgttcgcgaaaagctgtccaagcagaagatggctcctgtccgc aaggaagacggcgaacgcatggcaagagagcttggcgctgttaaatacgtcgaatgctct gccctcactcagtacaagctcaaggatgttttcgacgaggccatcgttgctgctctcgag ccaccaagtactcgcaagaagtctcgcgtttgcaaaatactgtaa

DBGET integrated database retrieval system