Uncinocarpus reesii: UREG_01930 Help Entry UREG_01930        CDS       T01132                                  Name (RefSeq) protein rho5   KO K04513   Ras homolog gene family, member A Organism ure  Uncinocarpus reesii Pathway ure04011   MAPK signaling pathway - yeast ure04081   Hormone signaling ure04144   Endocytosis ure05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ure00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     UREG_01930   09133 Signaling molecules and interaction    04081 Hormone signaling     UREG_01930  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     UREG_01930  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     UREG_01930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ure04131]     UREG_01930   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ure04147]     UREG_01930    04031 GTP-binding proteins [BR:ure04031]     UREG_01930 Membrane trafficking [BR:ure04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     UREG_01930 Exosome [BR:ure04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    UREG_01930   Exosomal proteins of other body fluids (saliva and urine)    UREG_01930   Exosomal proteins of colorectal cancer cells    UREG_01930   Exosomal proteins of bladder cancer cells    UREG_01930 GTP-binding proteins [BR:ure04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     UREG_01930 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  8441692 NCBI-ProteinID:  XP_002542414 UniProt:  C4JJX3 LinkDB All DBs AA seq 193 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEVLHFCSGHPIILVGCKKD LRHDPRTIEELHKTSQKPVTPEQGEEIRKKIGAYKYLECSARTGDGVREVFECATRAALL AKTEKKKPRCRIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgagatccgacgaaagcttgtgattgttggtgacggtgcttgtggaaagacttgt cttttgattgtgttctccaagggcactttccctgaggtctacgtcccaaccgtcttcgaa aactacgttgctgatgtcgaagtcgatgggaaacatgtcgagctcgccctttgggatact gctggacaggaagactacgaccgtcttcgccccctctcctacccagattcccacgtgatt ctcatctgcttcgccattgattctccagactctttggacaacgttcaggagaagtggatc tctgaagttcttcacttctgctctggccaccctatcattcttgttgggtgcaagaaggat ttgcgtcacgacccccgcactatcgaagaattgcacaagacttctcagaagccagtcact cccgagcagggtgaggaaatccgcaagaagatcggtgcttacaaatacctcgaatgctct gccagaaccggcgacggtgtccgtgaagttttcgaatgcgccacccgtgctgcccttttg gcaaagaccgagaaaaagaagccccgctgccggatcttgtaa

DBGET integrated database retrieval system