Uncinocarpus reesii: UREG_03296 Help Entry UREG_03296        CDS       T01132                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism ure  Uncinocarpus reesii Pathway ure04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:ure00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     UREG_03296  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ure01009]     UREG_03296   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ure04131]     UREG_03296    03036 Chromosome and associated proteins [BR:ure03036]     UREG_03296   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ure04147]     UREG_03296 Protein phosphatases and associated proteins [BR:ure01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      UREG_03296 Membrane trafficking [BR:ure04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     UREG_03296 Chromosome and associated proteins [BR:ure03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      UREG_03296 Exosome [BR:ure04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    UREG_03296 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 EFhand_Ca_insen AIF-1 EH EF-hand_11 SPARC_Ca_bdg EF_EFCAB10_C FCaBP_EF-hand Dockerin_1 DUF5580_M TerB RNA_pol_Rpb4 Motif Other DBs NCBI-GeneID:  8442779 NCBI-ProteinID:  XP_002543779 UniProt:  C4JQ63 LinkDB All DBs AA seq 77 aa AA seqDB search MARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQD GDGRIDYNEFVQLMMQK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcacggaaaatgaaggatacagattccgaagaggagatccgggaagcattcaaggtg tttgaccgcgataacaacgggtttatctccgccgcagaattgcgccacgtcatgacctcg atcggcgagaaattgacggatgacgaggtggatgagatgatccgcgaggctgatcaggat ggtgatggcagaatcgattacaacgaatttgttcaactcatgatgcagaaataa

DBGET integrated database retrieval system