Usitatibacter rugosus: DSM104443_02195 Help Entry DSM104443_02195   CDS       T06990                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism uru  Usitatibacter rugosus Pathway uru01100   Metabolic pathways uru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:uru00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DSM104443_02195 (acpP)    00074 Mycolic acid biosynthesis     DSM104443_02195 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DSM104443_02195 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF5783 DUF6952 Motif Other DBs NCBI-ProteinID:  QJR11124 UniProt:  A0A6M4GXA6 LinkDB All DBs Position complement(2324168..2324404) Genome browser AA seq 78 aa AA seqDB search MDNLEARVKKIVAEQLGVAEADVKNESSFVEDLGADSLDNVELVMALEEEFECEIPDEEA EKITNVQQAIDYVKTHVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggacaacctcgaagcccgagtcaagaaaatcgtcgccgagcaactgggtgttgccgaa gcggacgtgaaaaatgaatcctccttcgtcgaagaccttggcgcagattccctggacaac gtggagctcgtgatggccctcgaagaggaattcgagtgcgagatccccgacgaggaagcg gagaagatcaccaacgtgcagcaggcgatcgactacgtgaagacgcacgtcaagtaa

DBGET integrated database retrieval system