Uruburuella suis: LVJ78_04850 Help Entry LVJ78_04850       CDS       T08067                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism usu  Uruburuella suis Pathway usu01100   Metabolic pathways usu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:usu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ78_04850    00074 Mycolic acid biosynthesis     LVJ78_04850   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ78_04850 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C FitA-like_RHH DUF1493 Motif Other DBs NCBI-ProteinID:  UOO80613 UniProt:  A0AAE9KJI2 LinkDB All DBs Position 1093411..1093659 Genome browser AA seq 82 aa AA seqDB search MTESEIRQILTDALVNLFEIEPERIAPDTNLYEDLEIDSIDAIDLIDYIKRQTGRKLLAD DFRSVRTVEDVVQAVLRKDAAQ NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgactgaaagcgaaatccgccagattctcaccgatgcgctggtgaacctgtttgaaatc gagcctgagcgcattgcaccggacacgaatctttatgaagatttggaaatcgacagcatc gatgccatcgatttgatcgactacatcaagcgccaaaccggccgcaagcttttggccgat gatttccgcagcgtgcgcacggtggaagatgtggtgcaggcggtgttgcgcaaagacgca gcgcaataa

DBGET integrated database retrieval system