Uruburuella suis: LVJ78_06425 Help Entry LVJ78_06425       CDS       T08067                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism usu  Uruburuella suis Brite KEGG Orthology (KO) [BR:usu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:usu03032]     LVJ78_06425    03036 Chromosome and associated proteins [BR:usu03036]     LVJ78_06425    03400 DNA repair and recombination proteins [BR:usu03400]     LVJ78_06425 DNA replication proteins [BR:usu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     LVJ78_06425 Chromosome and associated proteins [BR:usu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     LVJ78_06425 DNA repair and recombination proteins [BR:usu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       LVJ78_06425 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 UBA_HYPK HU-CCDC81_euk_2 HU-DNA_bdg VWA_3 Myb_DNA-bind_8 HU-CCDC81_euk_1 WHD_TBPIP Lmo2446-like_N Motif Other DBs NCBI-ProteinID:  UOO78361 UniProt:  A0AAE9KFM5 LinkDB All DBs Position 1427127..1427396 Genome browser AA seq 89 aa AA seqDB search MNKSELIEAIAQEADISKAAATKALDGLMNAVTKALKEGDTVTLVGFGTFYVGERAERQG RNPQTGAPLTIAAAKTPKFRAGKALKDAL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtctgaattgattgaagccattgcccaagaagccgacatctctaaagctgcc gctaccaaagctttggacggcttgatgaatgctgtgaccaaagctttgaaagaaggcgac accgtaacgctggtcggtttcggcactttctacgttggtgagcgtgcagagcgtcaaggc cgcaatccgcaaaccggtgcgccgctgaccattgctgctgctaaaacaccgaaattccgc gccggtaaagcgctgaaagacgcgctgtaa

DBGET integrated database retrieval system