Uruburuella suis: LVJ78_10050 Help Entry LVJ78_10050       CDS       T08067                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism usu  Uruburuella suis Pathway usu01100   Metabolic pathways usu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:usu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LVJ78_10050 (acpP)    00074 Mycolic acid biosynthesis     LVJ78_10050 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LVJ78_10050 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 HLH DUF1493 EarP Motif Other DBs NCBI-ProteinID:  UOO79024 UniProt:  A0AAE9GU44 LinkDB All DBs Position complement(2207903..2208139) Genome browser AA seq 78 aa AA seqDB search MSNIEQQVKKIVAEQLGVNEAEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEEA EKITTVQLAIDYITAHNG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtcaaacattgaacaacaagttaaaaaaattgttgccgaacaactgggcgtaaatgaa gccgaagtgaaaaacgaatcttcattccaagacgatttgggcgccgactctctggatacc gttgagctggtaatggctctggaagaagcgttcggttgcgaaattcccgatgaagaagct gaaaaaatcaccaccgttcagctggctatcgattacatcacagcccacaacggttaa

DBGET integrated database retrieval system